Rv3531c Family assigned · low auto-curated · to review

H37Rv Rv3531c · MTBC0 mtbc0_003748 · 375 aa · 3991494–3992621 (-) · RefSeq NP_218048.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 3u07-assembly2_B Crystal Structure of the VPA0106 protein from Vibrio parahaemol (prob 1.00, TM 0.41). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt I6XHH2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF1214 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionConserved Protein
Orthologous groupCOG5361

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.327 · purifying
Polymorphic sites (≥ 0.1% of strains) 10 synonymous, 10 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.1 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6ans-assembly2_D 1.00 0.83 1.5e-32 sig 6ans-assembly2_D Crystal structure of a putative uncharacterized protein from Burkholderia cenocepacia
3u07-assembly2_B 1.00 0.41 3.8e-11 sig 3u07-assembly2_B Crystal Structure of the VPA0106 protein from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR106.
3u07-assembly3_C 1.00 0.43 3.0e-10 sig 3u07-assembly3_C Crystal Structure of the VPA0106 protein from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR106.
8jun-assembly1_B 0.97 0.23 4.3e-06 sig 8jun-assembly1_B Cryo-EM structure of SIDT1 E555Q mutant
5w6h-assembly1_C 0.77 0.46 3.5e-02 5w6h-assembly1_C Crystal structure of Bacteriophage CBA120 tailspike protein 4 enzymatically active domain (TSP4dN, orf213)
3lkj-assembly1_B 0.75 0.35 7.4e-03 sig 3lkj-assembly1_B Small Molecule Inhibition of the TNF Family Cyokine CD40 Ligand Through a Subunit Fracture Mechanism
1o6u-assembly3_E 0.69 0.49 7.6e-02 1o6u-assembly3_E The Crystal Structure of Human Supernatant Protein Factor
6qe7-assembly3_C 0.63 0.19 8.4e-05 sig 6qe7-assembly3_C anti-sigma factor domain-containing protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3530c (oxidoreductase), high confidence from genomic context alone (score 972 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3529c hyp hypothetical protein 975 975 ctx neighborhood:881 cooccurence:774
Rv3530c oxidoreductase 996 972 ctx neighborhood:882 cooccurence:646 textmining:870
Rv3526 kshA 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit 817 817 ctx cooccurence:766
Rv0310c hyp hypothetical protein 785 786 ctx cooccurence:746
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 769 769 ctx cooccurence:735
Rv3542c chsH2 hyp hypothetical protein 731 731 ctx cooccurence:728
Rv3568c hsaC extradiol dioxygenase 728 728 ctx cooccurence:716
Rv3541c chsH1 hyp hypothetical protein 707 707 ctx cooccurence:704
Rv3521 hyp hypothetical protein 704 704 ctx cooccurence:703
Rv3537 kstD 3-oxosteroid 1-dehydrogenase 700 700 ctx cooccurence:664
Rv1817 flavoprotein 666 666 ctx cooccurence:665
Rv3552 CoA-transferase subunit beta 653 653 ctx cooccurence:651
Rv3551 CoA-transferase subunit alpha 641 641 ctx cooccurence:639
Rv3527 hyp hypothetical protein 638 638 ctx cooccurence:540
Rv0311 hyp hypothetical protein 636 637 ctx cooccurence:635

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 6ans-assembly2_D Crystal structure of a putative uncharacterized protein from Bu (prob 1.00, E=1e-32, TM=0.83)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218048.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5361
  • Curated reference: UniProt I6XHH2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.1, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor Rv3530c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003748|Rv3531c|
MYSDPLREAIAEAEQLVAAAPHIETEADLLEGLQYLAGCIAGCMHLAFDYERDHPFLQSGTGPFTKMGLDNPDTLYFGTRLQANRDYVVSGRRGTTTDLSFQLLGGEYTDYNVPASQAAFDDRELDIAADGSFEWRLRPSAPGQLVIREVYGDWSQQRGTLAIARLDTVGTAPPPLTRELMEKRYATAGSQLVNRVKTWLQFPQWFYLNIPVNTMVAPRLTPGGLATQYSSAGHFELRPGQALVITVPVSDAPYLGFQLGSMWYISLDYINHQTSLNASQAQADPDGKVRIVVAEQNPGVTNWVETLGHRRGFLQFRWQRVSRELTEADGPTVELVDFDAIPAALPHYQHNKISEDDWRARIALRQRQIATRMLG