ispD Resolved · high auto-curated
H37Rv Rv3582c · MTBC0 mtbc0_003801 ·
231 aa ·
4048021–4048716 MTBC0
(-) ·
RefSeq NP_218099.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
| Revised (this work) | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. Pfam: IspD (PF01128.26), CTP_transf_3 (PF02348.26), NTP_transf_3 (PF12804.14). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 21 publications
21 TB publications mention this gene. 21 publication(s) discuss this gene (18 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (5)).
| Publication | Date |
|---|---|
| Identification of Natural-Product Inhibitors of the 2C‑Methyl‑d‑erythritol 4‑Phosphate Pathway. doi:10.1021/acsmedchemlett.6c00054 | 2026 |
| Diagnostic challenges in peritoneal dialysis-associated peritonitis with atypical and rare pathogens: A new era of metagenomic next-generation sequencing precision diagnosis. doi:10.1177/08968608251333879 | 2026 |
| Targeting IspD for Anti-infective and Herbicide Development: Exploring Its Role, Mechanism, and Structural Insights. doi:10.1021/acs.jmedchem.4c01146 | 2025 |
| Fragment Discovery by X-Ray Crystallographic Screening Targeting the CTP Binding Site of Pseudomonas Aeruginosa IspD. doi:10.1002/anie.202414615 | 2025 |
| Identification of IspD as a novel target for tuberculosis treatment using compound M6. doi:10.3389/fmicb.2024.1461227 | 2024 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | ispF (Rv3581c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -2.27 (95% CI -2.51 to -2.04). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the third step). Catalyzes the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) from CTP and 2C-methyl-D-erythritol 4-phosphate (MEP). |
|---|---|
| Mycobrowser EC |
2.7.7.60
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3613c
· 99.6% identity |
|---|---|
| M. leprae |
ML0321
· 66.9% identity |
| M. marinum |
MMAR_5082
· 76.3% identity |
| M. smegmatis |
MSMEG_6076
· 62.6% identity |
| M. orygis |
RJtmp_003690
· 100.0% identity |
| M. abscessus |
MAB_0569
· 52.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKG9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
| EC (curated) |
EC 2.7.7.60
|
| Curated function | Catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | ispD |
| eggNOG description | Catalyzes the formation of 4-diphosphocytidyl-2-C- methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4- phosphate (MEP) |
| Orthologous group | COG1211 |
| EC number |
EC 2.7.7.60
|
| KEGG orthology |
K00991
|
| KEGG pathways |
map00900, map01100, map01110, map01130
|
| KEGG modules |
M00096
|
| Gene Ontology (73) |
GO:0000166, GO:0000287, GO:0001882, GO:0001884, GO:0002135, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006081 +61 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.264 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 74.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 45.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 13 in the ORF — 13 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | ispD-TetOn18.1 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 2.602 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 157.0 ppm · rank 993/3519 (71.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 231 aa |
|---|---|
| Molecular weight | 24.1 kDa |
| Theoretical pI | 4.71 |
| GRAVY | 0.29 (hydrophobic) |
| Aliphatic index | 116.1 |
| Aromaticity | 0.035 |
| Instability index | 24.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
IspD | PF01128.26 | 2.1e-86 | 8–230 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase |
CTP_transf_3 | PF02348.26 | 5.3e-06 | 9–150 | Cytidylyltransferase |
NTP_transf_3 | PF12804.14 | 1.8e-09 | 10–135 | MobA-like NTP transferase domain |
Experimental structures (Protein Data Bank) 4 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3q80 |
X-ray diffraction | 2.0 Å | 100% |
3q7u |
X-ray diffraction | 2.1 Å | 100% |
3okr |
X-ray diffraction | 2.4 Å | 100% |
2xwn |
X-ray diffraction | 2.9 Å | 99% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2xwn-assembly1_B |
1.00 | 0.98 | 2.5e-44 sig | 2xwn-assembly1_B Crystal structure of IspD from Mycobacterium tuberculosis in complex with CTP and Mg |
3q7u-assembly1_A |
1.00 | 0.99 | 8.3e-44 sig | 3q7u-assembly1_A Structure of Mtb 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD) complexed with CTP |
3q7u-assembly1_B |
1.00 | 0.97 | 7.8e-44 sig | 3q7u-assembly1_B Structure of Mtb 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD) complexed with CTP |
3q80-assembly1_A |
1.00 | 0.99 | 7.7e-43 sig | 3q80-assembly1_A Structure of Mtb 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD) Complexed with CDP-ME |
2xwn-assembly1_A |
1.00 | 0.98 | 3.1e-43 sig | 2xwn-assembly1_A Crystal structure of IspD from Mycobacterium tuberculosis in complex with CTP and Mg |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | ispF (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3583c (- strand, 16 bp gap) |
| Predicted operon |
ispF · ispD · Rv3583c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0576 (represses) · Rv1353c (activates) · Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: ispF (2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3581c ispF |
2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 999 | 1000 ctx | neighborhood:882 fusion:900 cooccurence:770 coexpression:949 textmining:965 |
Rv2870c dxr exp |
1-deoxy-D-xylulose 5-phosphate reductoisomerase | 998 | 977 ctx | cooccurence:762 database:900 textmining:957 |
Rv1011 ispE exp |
4-diphosphocytidyl-2C-methyl-D-erythritol kinase | 998 | 974 ctx | cooccurence:730 database:900 textmining:949 |
Rv3583c carD |
RNA polymerase-binding transcription factor CarD | 955 | 887 ctx | neighborhood:865 textmining:622 |
Rv3579c rlmB |
23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | 800 | 800 ctx | neighborhood:799 |
Rv3580c cysS1 |
cysteine--tRNA ligase | 800 | 800 ctx | neighborhood:799 |
Rv2868c gcpE |
4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) | 986 | 762 ctx | cooccurence:751 textmining:948 |
Rv1110 lytB2 |
4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 910 | 761 ctx | cooccurence:750 textmining:642 |
Rv3382c lytB1 |
4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 945 | 759 ctx | cooccurence:749 textmining:785 |
Rv3586 disA |
DNA integrity scanning protein DisA | 691 | 692 ctx | neighborhood:491 coexpression:419 |
Rv3585 radA |
DNA repair protein RadA | 710 | 665 ctx | neighborhood:453 coexpression:412 |
Rv2682c dxs1 |
1-deoxy-D-xylulose 5-phosphate synthase | 969 | 659 ctx | cooccurence:619 textmining:915 |
Rv3379c dxs2 |
1-deoxy-D-xylulose-5-phosphate synthase | 799 | 618 ctx | cooccurence:577 textmining:496 |
Rv3584 lpqE |
lipoprotein LpqE | 450 | 451 ctx | neighborhood:448 |
Rv2881c cdsA |
phosphatidate cytidylyltransferase | 430 | 224 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
- MTBC0 PGAP product: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
- Pfam (hmmscan --cut_ga): IspD PF01128.26 (E=2e-86), CTP_transf_3 PF02348.26 (E=5e-06), NTP_transf_3 PF12804.14 (E=2e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218099.1)
- Domains: Pfam-A via hmmscan --cut_ga — IspD (PF01128.26), CTP_transf_3 (PF02348.26), NTP_transf_3 (PF12804.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1211 - Curated reference: UniProt P9WKG9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
ispF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003801|Rv3582c|ispD MVREAGEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLDLPAAEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ispD? Email the maintainer — the message is pre-filled with this gene's details.