arsB2 Resolved · high auto-curated

H37Rv Rv3578 · MTBC0 mtbc0_003797 · 413 aa · 4043819–4045060 (+) · RefSeq NP_218095.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)arsenic transport integral membrane protein ArsB
MTBC0 PGAP re-annotationarsenic transport integral membrane protein ArsB
Revised (this work)Arsenic transport integral membrane protein ArsB. Pfam: ArsB (PF02040.21), CitMHS (PF03600.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YCG9 TrEMBL · unreviewed · Inferred from homology
UniProt namePossible arsenical pump integral membrane protein ArsB2

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namearsB
eggNOG descriptionArsenical pump membrane protein
Orthologous groupCOG1055
KEGG orthology K03893

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.853 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 8 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.45% of strains (649) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ArsBPF02040.21 2.5e-233–399 Arsenical pump membrane protein
CitMHSPF03600.23 2.4e-3324–343 Citrate transporter

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lppH (lipoprotein LppH), medium confidence from genomic context alone (score 583 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3577 hyp hypothetical protein 875 875 ctx neighborhood:867
Rv3576 lppH lipoprotein LppH 584 583 ctx neighborhood:581
Rv1885c chorismate mutase 490 490 ctx cooccurence:486
Rv3575c LacI family transcriptional regulator 475 447 ctx neighborhood:444
Rv2655c prophage protein 440 441 ctx cooccurence:437
Rv0053 rpsF 30S ribosomal protein S6 408 409 coexpression:407
Rv0067c transcriptional regulator 424 184
Rv1226c transmembrane protein 422 183
Rv2643 arsC arsenic-transport integral membrane protein ArsC 400 161
Rv1282c oppC oligopeptide ABC transporter permease OppC 429 101

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: arsenic transport integral membrane protein ArsB
  • MTBC0 PGAP product: arsenic transport integral membrane protein ArsB
  • Pfam (hmmscan --cut_ga): ArsB PF02040.21 (E=3e-23), CitMHS PF03600.23 (E=2e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218095.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ArsB (PF02040.21), CitMHS (PF03600.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1055
  • Curated reference: UniProt I6YCG9 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor lppH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003797|Rv3578|arsB2
MTLAVALILLAVVLGFAVARPRGWPEAAAAVPAAVILLAIGAISPQQAMAQVSGLARVVAFLGAVLVLAKLCDDEGLFEAAGAAMARASAESHRLLRQVFAVSAAITAALCLDATVVLLTPVVLATVRRLRTPVRPYAYATAHLANAASLLLPVSNLTNLLAYHGAGISFTKFTLLMALPWLSAVAAVYVVFRWFFARDLRVVPDRQQLKPAPRLPMFVLVVVALTLGGFAVAESVGLAPTWAALAGAAVLALRSLRRGHTSVLRIARAVNVSFLVFVLALGVVVHAVMLNGMAARMSAVLPTGSGLPALLGIAALAAVLANVVNNLPATLVLVPLVAAGGPAAVLAVLLGVNIGPNLTYAGSLSNLLWRGVLRRHNVDASVGEYTRLGLCTVPAALAMAVLALWASAQVLGI