Rv3575c Family assigned · medium auto-curated

H37Rv Rv3575c · MTBC0 mtbc0_003794 · 359 aa · 4040766–4041845 (-) · RefSeq NP_218092.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)LacI family transcriptional regulator
MTBC0 PGAP re-annotationLacI family DNA-binding transcriptional regulator
Revised (this work)LacI family DNA-binding transcriptional regulator. Pfam: Peripla_BP_1 (PF00532.28), Peripla_BP_3 (PF13377.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96857 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator Rv3575c
Curated functionTranscriptional regulator that negatively regulates transcription of the mce4 operon, which is involved in cholesterol transport and utilization. Acts by binding to the promoter region of the mce4 operon. It affects the utilization of host cholesterol as a carbon source, impacting the host's innate immune response.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionPeriplasmic binding protein LacI transcriptional regulator
Orthologous groupCOG1609

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.078 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peripla_BP_1PF00532.28 1.2e-0869–305 Periplasmic binding proteins and sugar binding domain of LacI family
Peripla_BP_3PF13377.13 8.2e-15182–333 Periplasmic binding protein-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: xylB (D-xylulose kinase XylB), medium confidence from genomic context alone (score 679 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3859c gltB glutamate synthase large subunit 976 963 experimental:963
Rv3396c guaA GMP synthase 764 759 experimental:757
Rv0729 xylB D-xylulose kinase XylB 754 679 ctx cooccurence:489
Rv3577 hyp hypothetical protein 676 676 ctx neighborhood:674
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 676 663 experimental:650
Rv0186 bglS beta-glucosidase BglS 591 566 ctx cooccurence:551
Rv3576 lppH lipoprotein LppH 583 562 ctx neighborhood:562
Rv2059 hyp hypothetical protein 553 549 ctx neighborhood:544
Rv2060 integral membrane protein 563 544 ctx neighborhood:544
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 536 536 experimental:536
Rv1940 ribA1 riboflavin biosynthesis protein RibA 536 536 experimental:536
Rv0620 galK galactokinase 627 513
Rv2474c hyp hypothetical protein 503 504 ctx cooccurence:501
Rv0792c transcriptional regulator 570 492 ctx cooccurence:492
Rv2986c hupB DNA-binding protein HU 507 451 experimental:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: LacI family transcriptional regulator
  • MTBC0 PGAP product: LacI family DNA-binding transcriptional regulator
  • Pfam (hmmscan --cut_ga): Peripla_BP_1 PF00532.28 (E=1e-08), Peripla_BP_3 PF13377.13 (E=8e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218092.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peripla_BP_1 (PF00532.28), Peripla_BP_3 (PF13377.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1609
  • Curated reference: UniProt P96857 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 76 functional partner(s); context anchor xylB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003794|Rv3575c|
MSPTPRRRATLASLAAELKVSRTTVSNAFNRPDQLSADLRERVLATAKRLGYAGPDPVARSLRTRKAGAVGLVMAEPLTYFFSDPAARDFVAGVAQSCEELGQGLQLVSVGSSRSLADGTAAVLGAGVDGFVVYSVGDDDPYLQVVLQRRLPVVVVDQPKDLSGVSRVGIDDRAAMRELAGYVLGLGHRELGLLTMRLGRDRRQDLVDAERLRSPTFDVQRERIVGVWEAMTAAGVDPDSLTVVESYEHLPTSGGTAAKVALQANPRLTALMCTADILALSAMDYLRAHGIYVPGQMTVTGFDGVPEALSRGLTTVAQPSLHKGHRAGELLLKPPRSGLPVIEVLDTELVRGRTAGPPA