deoD Resolved · high auto-curated
H37Rv Rv3307 · MTBC0 mtbc0_003515 ·
268 aa ·
3716192–3716998 MTBC0
(+) ·
RefSeq NP_217824.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | purine nucleoside phosphorylase |
|---|---|
| MTBC0 PGAP re-annotation | purine-nucleoside phosphorylase |
| Revised (this work) | Purine-nucleoside phosphorylase. Pfam: PNP_UDP_1 (PF01048.27). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Assessing the role of deoD gene in Mycobacterium tuberculosis in vitro growth and macrophage infection. doi:10.1016/j.micpath.2018.03.056 | 2018 |
| Purine nucleoside phosphorylase from Mycobacterium tuberculosis. Analysis of inhibition by a transition-state analogue and dissection by parts. doi:10.1021/bi010584x | 2001 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.17 (95% CI -0.64 to 1.40). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in purine nucleoside salvage. Cleavage of guanosine or inosine to respective BASES and sugar-1-phosphate molecules [catalytic activity: purine nucleoside + orthophosphate = purine + alpha-D-ribose 1-phosphate]. |
|---|---|
| Mycobrowser EC |
2.4.2.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3335
· 99.6% identity |
|---|---|
| M. leprae |
ML0707c
· 82.1% identity |
| M. marinum |
MMAR_1219
· 85.3% identity |
| M. smegmatis |
MSMEG_1701
· 79.3% identity |
| M. orygis |
RJtmp_003407
· 99.6% identity |
| M. abscessus |
MAB_3660
· 75.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WP01
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Purine nucleoside phosphorylase |
| EC (curated) |
EC 2.4.2.1
|
| Curated function | The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate. Cleaves guanosine, inosine, 2'-deoxyguanosine and 2'-deoxyinosine. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | punA |
| eggNOG description | The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate |
| Orthologous group | COG0005 |
| EC number |
EC 2.4.2.1
|
| KEGG orthology |
K03783
|
| KEGG pathways |
map00230, map00240, map00760, map01100, map01110
|
| Gene Ontology (48) |
GO:0003674, GO:0003824, GO:0004731, GO:0006139, GO:0006152, GO:0006161, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0009056, GO:0009116 +36 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.81 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 81.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 60.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 111. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +1.88 | 0.004 | required |
| Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +1.11 | 0.027 | required |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 93.0 ppm · rank 1345/3519 (61.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 268 aa |
|---|---|
| Molecular weight | 27.6 kDa |
| Theoretical pI | 5.51 |
| GRAVY | 0.256 (hydrophobic) |
| Aliphatic index | 108.2 |
| Aromaticity | 0.034 |
| Instability index | 32.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PNP_UDP_1 | PF01048.27 | 9.8e-46 | 30–266 | Phosphorylase superfamily |
Experimental structures (Protein Data Bank) 8 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8c25 |
X-ray diffraction | 1.56 Å | 100% |
1g2o |
X-ray diffraction | 1.75 Å | 100% |
7zsq |
X-ray diffraction | 1.77 Å | 100% |
3scz |
X-ray diffraction | 1.95 Å | 100% |
7zsr |
X-ray diffraction | 1.97 Å | 100% |
1i80 |
X-ray diffraction | 2.0 Å | 100% |
3ix2 |
X-ray diffraction | 2.1 Å | 100% |
3iom |
X-ray diffraction | 2.14 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (8 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7zsq-assembly1_C |
1.00 | 0.94 | 4.6e-54 sig | 7zsq-assembly1_C human purine nucleoside phosphorylase in complex with JS-555 |
1qe5-assembly1_C |
1.00 | 0.92 | 1.2e-36 sig | 1qe5-assembly1_C PURINE NUCLEOSIDE PHOSPHORYLASE FROM CELLULOMONAS SP. IN COMPLEX WITH PHOSPHATE |
4m1e-assembly1_B |
1.00 | 0.93 | 3.1e-30 sig | 4m1e-assembly1_B Crystal structure of purine nucleoside phosphorylase I from Planctomyces limnophilus DSM 3776, NYSGRC Target 029364. |
6tk9-assembly1_F |
1.00 | 0.92 | 2.8e-28 sig | 6tk9-assembly1_F Purine-nucleoside phosphorylase from Thermus thermophilus |
4nsn-assembly1_C |
1.00 | 0.91 | 6.5e-29 sig | 4nsn-assembly1_C Crystal structure of purine nucleoside phosphorylase from Porphyromonas gingivalis ATCC 33277, NYSGRC Target 030972, orthorhombic symmetry |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | amiB1 (- strand, 64 bp gap) |
|---|---|
| Downstream (3' on genome) | pmmB (+ strand, 3 bp gap) |
| Predicted operon |
deoD · pmmB
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: cdd (cytidine deaminase), high confidence from genomic context alone (score 971 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3315c cdd exp |
cytidine deaminase | 971 | 971 ctx | cooccurence:600 database:924 |
Rv3308 pmmB |
phosphomannomutase PmmB | 958 | 956 ctx | neighborhood:881 cooccurence:438 |
Rv3314c deoA exp |
thymidine phosphorylase | 991 | 951 ctx | cooccurence:478 database:900 textmining:826 |
Rv2584c apt exp |
adenine phosphoribosyltransferase | 991 | 950 | database:938 textmining:831 |
Rv3313c add exp |
adenosine deaminase | 953 | 938 | database:922 |
Rv3624c hpt exp |
hypoxanthine-guanine phosphoribosyltransferase | 975 | 925 | database:900 textmining:693 |
Rv3393 iunH exp |
nucleoside hydrolase | 963 | 917 | database:900 textmining:583 |
Rv2202c adoK exp |
adenosine kinase | 938 | 914 | database:900 |
Rv3309c upp exp |
uracil phosphoribosyltransferase | 976 | 911 | database:900 textmining:747 |
Rv1151c cobB exp |
NAD-dependent protein deacylase | 935 | 904 | database:900 |
Rv0573c pncB2 exp |
nicotinic acid phosphoribosyltransferase PncB2 | 909 | 904 | database:900 |
Rv1330c pncB1 exp |
nicotinic acid phosphoribosyltransferase PncB1 | 908 | 904 | database:900 |
Rv2344c dgt exp |
deoxyguanosine triphosphate triphosphohydrolase | 904 | 904 | database:900 |
Rv0212c nadR exp |
transcriptional regulator NadR | 903 | 904 | database:900 |
Rv2043c pncA exp |
pyrazinamidase/nicotinamidase PncA | 908 | 903 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: purine nucleoside phosphorylase
- MTBC0 PGAP product: purine-nucleoside phosphorylase
- Pfam (hmmscan --cut_ga): PNP_UDP_1 PF01048.27 (E=1e-45)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217824.1)
- Domains: Pfam-A via hmmscan --cut_ga — PNP_UDP_1 (PF01048.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0005 - Curated reference: UniProt P9WP01 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
cdd - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003515|Rv3307|deoD MADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for deoD? Email the maintainer — the message is pre-filled with this gene's details.