deoD Resolved · high auto-curated

H37Rv Rv3307 · MTBC0 mtbc0_003515 · 268 aa · 3716192–3716998 (+) · RefSeq NP_217824.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)purine nucleoside phosphorylase
MTBC0 PGAP re-annotationpurine-nucleoside phosphorylase
Revised (this work)Purine-nucleoside phosphorylase. Pfam: PNP_UDP_1 (PF01048.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP01 SwissProt · reviewed · Evidence at protein level
UniProt namePurine nucleoside phosphorylase
EC (curated) EC 2.4.2.1
Curated functionThe purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate. Cleaves guanosine, inosine, 2'-deoxyguanosine and 2'-deoxyinosine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namepunA
eggNOG descriptionThe purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate
Orthologous groupCOG0005
EC number EC 2.4.2.1
KEGG orthology K03783
KEGG pathways map00230, map00240, map00760, map01100, map01110
Gene Ontology (48) GO:0003674, GO:0003824, GO:0004731, GO:0006139, GO:0006152, GO:0006161, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0009056, GO:0009116 +36 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.81 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PNP_UDP_1PF01048.27 9.8e-4630–266 Phosphorylase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cdd (cytidine deaminase), high confidence from genomic context alone (score 971 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3315c cdd cytidine deaminase 971 971 ctx cooccurence:600 database:924
Rv3308 pmmB phosphomannomutase PmmB 958 956 ctx neighborhood:881 cooccurence:438
Rv3314c deoA thymidine phosphorylase 991 951 ctx cooccurence:478 database:900 textmining:826
Rv2584c apt adenine phosphoribosyltransferase 991 950 database:938 textmining:831
Rv3313c add adenosine deaminase 953 938 database:922
Rv3624c hpt hypoxanthine-guanine phosphoribosyltransferase 975 925 database:900 textmining:693
Rv3393 iunH nucleoside hydrolase 963 917 database:900 textmining:583
Rv2202c adoK adenosine kinase 938 914 database:900
Rv3309c upp uracil phosphoribosyltransferase 976 911 database:900 textmining:747
Rv1151c cobB NAD-dependent protein deacylase 935 904 database:900
Rv0573c pncB2 nicotinic acid phosphoribosyltransferase PncB2 909 904 database:900
Rv1330c pncB1 nicotinic acid phosphoribosyltransferase PncB1 908 904 database:900
Rv2344c dgt deoxyguanosine triphosphate triphosphohydrolase 904 904 database:900
Rv0212c nadR transcriptional regulator NadR 903 904 database:900
Rv2043c pncA pyrazinamidase/nicotinamidase PncA 908 903 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: purine nucleoside phosphorylase
  • MTBC0 PGAP product: purine-nucleoside phosphorylase
  • Pfam (hmmscan --cut_ga): PNP_UDP_1 PF01048.27 (E=1e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217824.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PNP_UDP_1 (PF01048.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0005
  • Curated reference: UniProt P9WP01 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor cdd
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003515|Rv3307|deoD
MADPRPDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF