Rv3304 Resolved · high auto-curated

H37Rv Rv3304 · MTBC0 mtbc0_003512 · 159 aa · 3713279–3713758 (+) · RefSeq NP_217821.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationgamma-glutamylcyclotransferase
Revised (this work)Gamma-glutamylcyclotransferase. Pfam: GGACT (PF06094.18), AIG2_2 (PF13772.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53356 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionAIG2-like family
Orthologous groupCOG3703

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GGACTPF06094.18 2.8e-095–114 Gamma-glutamyl cyclotransferase, AIG2-like
AIG2_2PF13772.12 2.1e-2559–145 AIG2-like family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpdA (NAD(P)H quinone reductase LpdA), high confidence from genomic context alone (score 762 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3303c lpdA NAD(P)H quinone reductase LpdA 951 762 ctx neighborhood:757 textmining:805
Rv3302c glpD2 glycerol-3-phosphate dehydrogenase 909 753 ctx neighborhood:751 textmining:650
Rv3231c hyp hypothetical protein 639 639 ctx cooccurence:638
Rv3916c hyp hypothetical protein 608 608 ctx cooccurence:608
Rv3118 sseC1 hyp hypothetical protein 601 602 ctx cooccurence:599
Rv0814c sseC2 hyp hypothetical protein 601 601 ctx cooccurence:599
Rv1332 transcriptional regulator 596 596 ctx cooccurence:596
Rv0051 transmembrane protein 519 520 ctx cooccurence:518
Rv1159 pimE polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase 493 494 ctx cooccurence:492
Rv2181 alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase 471 471 ctx cooccurence:468
Rv1402 priA primosomal protein N' 430 431 ctx cooccurence:428
Rv3604c transmembrane protein 423 423 ctx cooccurence:422
Rv3300c hyp hypothetical protein 790 419 ctx neighborhood:417 textmining:653
Rv0955 integral membrane protein 408 409 ctx cooccurence:404
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 622 360 textmining:434

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: gamma-glutamylcyclotransferase
  • Pfam (hmmscan --cut_ga): GGACT PF06094.18 (E=3e-09), AIG2_2 PF13772.12 (E=2e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217821.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GGACT (PF06094.18), AIG2_2 (PF13772.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3703
  • Curated reference: UniProt O53356 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor lpdA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003512|Rv3304|
MPLYAAYGSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALATVVEDPDSKVFVVLYDMTPADEKNLDRWEGSEFGIHQKIRCRVERISSDTTTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPSDYVHDLRTRPARNIGPGTIA