upp Resolved · high auto-curated

H37Rv Rv3309c · MTBC0 mtbc0_003517 · 207 aa · 3718608–3719231 MTBC0 (-) · RefSeq NP_217826.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand atsB (Rv3299c) — requalified: arylsulfatase AtsB atsB Rv3300c (Rv3300c) — family_assigned: RluA family pseudouridine synthase Rv3300c phoY1 (Rv3301c) — requalified: phosphate signaling complex protein PhoU glpD2 (Rv3302c) — requalified: glycerol-3-phosphate dehydrogenase/oxidase glpD2 lpdA (Rv3303c) — requalified: NAD(P)H-quinone dehydrogenase lpdA Rv3304 (Rv3304) — requalified: gamma-glutamylcyclotransferase deoD (Rv3307) — requalified: purine-nucleoside phosphorylase pmmB (Rv3308) — requalified: phospho-sugar mutase pmmB upp (Rv3309c) — requalified: uracil phosphoribosyltransferase sapM (Rv3310) — requalified: phosphatidylinositol-3-phosphatase sapM Rv3311 (Rv3311) — family_assigned: primosomal protein Rv3311 Rv3312c (Rv3312c) — family_assigned: alpha/beta hydrolase Rv3312c add (Rv3313c) — requalified: adenosine deaminase add deoA (Rv3314c) — requalified: thymidine phosphorylase deoA cdd (Rv3315c) — requalified: cytidine deaminase sdhC (Rv3316) — family_assigned: succinate dehydrogenase%2C cytochrome b556 subunit sdhD (Rv3317) — family_assigned: succinate dehydrogenase hydrophobic membrane anchor subunit sdhA (Rv3318) — family_assigned: succinate dehydrogenase flavoprotein subunit sdhA sdhB (Rv3319) — family_assigned: succinate dehydrogenase iron-sulfur subunit vapC44 (Rv3320c) — family_assigned: type II toxin-antitoxin system VapC family toxin vapB44 (Rv3321c) — family_assigned: CopG family transcriptional regulator 3 708 kb 3 712 kb 3 716 kb 3 720 kb 3 724 kb 3 728 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)uracil phosphoribosyltransferase
MTBC0 PGAP re-annotationuracil phosphoribosyltransferase
Revised (this work)Uracil phosphoribosyltransferase. Pfam: UPRTase (PF14681.13), Pribosyltran (PF00156.34).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 7 publications

7 TB publications mention this gene. 7 publication(s) discuss this gene (8 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

Most recent 5 of 7.
PublicationDate
Targeting Proteasomes in Cancer and Infectious Disease: A Parallel Strategy to Treat Malignancies and Microbes. doi:10.3389/fcimb.2022.925804 2022
ISCCM Guidelines for the Use of Non-invasive Ventilation in Acute Respiratory Failure in Adult ICUs. doi:10.5005/jp-journals-10071-G23186 2020
Analysis of uracil phosphoribosyltransferase expression in Mycobacterium tuberculosis and evaluation of upp knockout strain in infected mice. doi:10.1093/femsle/fnx023 2017
Structural basis of mapping the spontaneous mutations with 5-flurouracil in uracil phosphoribosyltransferase from Mycobacterium tuberculosis. doi:10.1016/j.bbrc.2015.09.133 2015
The complex mechanism of antimycobacterial action of 5-fluorouracil. doi:10.1016/j.chembiol.2014.11.006 2015

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.65 (95% CI -1.50 to 5.29). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in pyrimidine salvage pathway [catalytic activity: UMP + pyrophosphate = uracil + 5-phospho-alpha-D-ribose 1-diphosphate].
Mycobrowser EC 2.4.2.9 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3337c · 100.0% identity
M. marinum MMAR_1217 · 82.1% identity
M. smegmatis MSMEG_1694 · 76.8% identity
M. orygis RJtmp_003409 · 99.5% identity
M. abscessus MAB_3662c · 71.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WFF3 SwissProt · reviewed · Evidence at protein level
UniProt nameUracil phosphoribosyltransferase
EC (curated) EC 2.4.2.9
Curated functionCatalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nameupp
eggNOG descriptionCatalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate
Orthologous groupCOG0035
EC number EC 2.4.2.9
KEGG orthology K00761
KEGG pathways map00240, map01100
Gene Ontology (92) GO:0003674, GO:0003824, GO:0004849, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006139, GO:0006206, GO:0006213 +80 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.51 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 76.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 58.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 8 in the ORF — 0 in the essential state, 0 growth-defect, 8 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 91.25. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance75.2 ppm · rank 1491/3519 (57.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length207 aa
Molecular weight21.9 kDa
Theoretical pI4.93
GRAVY0.197 (hydrophobic)
Aliphatic index108.4
Aromaticity0.034
Instability index26.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UPRTasePF14681.13 2.3e-665–205 Uracil phosphoribosyltransferase
PribosyltranPF00156.34 1.5e-0967–175 Phosphoribosyl transferase domain

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
5e38 X-ray diffraction 3.0 Å 99%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.2

PDB hitprobTM-scoreE-valueDescription
5e38-assembly1_C 1.00 0.97 5.5e-37 sig 5e38-assembly1_C Structural basis of mapping the spontaneous mutations with 5-flourouracil in uracil phosphoribosyltransferase from Mycobacterium tuberculosis
5e38-assembly1_B 1.00 0.96 2.0e-28 sig 5e38-assembly1_B Structural basis of mapping the spontaneous mutations with 5-flourouracil in uracil phosphoribosyltransferase from Mycobacterium tuberculosis
1v9s-assembly1_C 1.00 0.96 5.0e-27 sig 1v9s-assembly1_C Crystal structure of TT0130 protein from Thermus thermophilus HB8
1o5o-assembly1_B 1.00 0.95 5.7e-27 sig 1o5o-assembly1_B Crystal structure of Uracil phosphoribosyltransferase (TM0721) from Thermotoga maritima at 2.30 A resolution
2ehj-assembly1_A 1.00 0.96 8.2e-27 sig 2ehj-assembly1_A Structure of Uracil phosphoribosyl transferase

Foldseek search of the AlphaFold DB model (mean pLDDT 96.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)pmmB (+ strand, 1 bp gap)
Downstream (3' on genome)sapM (+ strand, 104 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: rpiB (ribose-5-phosphate isomerase B), high confidence from genomic context alone (score 916 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3314c deoA exp thymidine phosphorylase 994 952 coexpression:415 database:900 textmining:895
Rv2883c pyrH exp uridylate kinase 962 951 coexpression:453 database:900
Rv1385 pyrF exp orotidine 5'-phosphate decarboxylase 996 930 database:900 textmining:951
Rv2465c rpiB ribose-5-phosphate isomerase B 920 916 ctx fusion:899
Rv3307 deoD exp purine nucleoside phosphorylase 976 911 database:900 textmining:747
Rv3396c guaA GMP synthase 943 907 coexpression:895 textmining:418
Rv1379 pyrR exp bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase 989 900 database:900 textmining:895
Rv3310 sapM acid phosphatase 780 780 ctx neighborhood:780
Rv0070c glyA2 serine hydroxymethyltransferase 724 688 coexpression:662
Rv1093 glyA1 serine hydroxymethyltransferase 724 688 coexpression:662
Rv2890c rpsB 30S ribosomal protein S2 649 649 coexpression:648
Rv3311 hyp hypothetical protein 594 593 ctx neighborhood:592
Rv2889c tsf elongation factor EF-Ts 573 574 coexpression:572
Rv0700 rpsJ 30S ribosomal protein S10 538 538 coexpression:536
Rv1712 cmk exp cytidylate kinase 607 535 database:500

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: uracil phosphoribosyltransferase
  • MTBC0 PGAP product: uracil phosphoribosyltransferase
  • Pfam (hmmscan --cut_ga): UPRTase PF14681.13 (E=2e-66), Pribosyltran PF00156.34 (E=1e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217826.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UPRTase (PF14681.13), Pribosyltran (PF00156.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0035
  • Curated reference: UniProt P9WFF3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor rpiB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003517|Rv3309c|upp
MQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRDAPCEPVPIRTPLAETVGSRLTKPPLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPVPYLDSLPDDLTDVPVMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAAPEGIAALQKAAPNVRLFTAAIDEGLNEVAYIVPGLGDAGDRQFGPR