upp Resolved · high auto-curated

H37Rv Rv3309c · MTBC0 mtbc0_003517 · 207 aa · 3718608–3719231 (-) · RefSeq NP_217826.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)uracil phosphoribosyltransferase
MTBC0 PGAP re-annotationuracil phosphoribosyltransferase
Revised (this work)Uracil phosphoribosyltransferase. Pfam: UPRTase (PF14681.13), Pribosyltran (PF00156.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFF3 SwissProt · reviewed · Evidence at protein level
UniProt nameUracil phosphoribosyltransferase
EC (curated) EC 2.4.2.9
Curated functionCatalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nameupp
eggNOG descriptionCatalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate
Orthologous groupCOG0035
EC number EC 2.4.2.9
KEGG orthology K00761
KEGG pathways map00240, map01100
Gene Ontology (92) GO:0003674, GO:0003824, GO:0004849, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006139, GO:0006206, GO:0006213 +80 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.51 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UPRTasePF14681.13 2.3e-665–205 Uracil phosphoribosyltransferase
PribosyltranPF00156.34 1.5e-0967–175 Phosphoribosyl transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpiB (ribose-5-phosphate isomerase B), high confidence from genomic context alone (score 916 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3314c deoA thymidine phosphorylase 994 952 coexpression:415 database:900 textmining:895
Rv2883c pyrH uridylate kinase 962 951 coexpression:453 database:900
Rv1385 pyrF orotidine 5'-phosphate decarboxylase 996 930 database:900 textmining:951
Rv2465c rpiB ribose-5-phosphate isomerase B 920 916 ctx fusion:899
Rv3307 deoD purine nucleoside phosphorylase 976 911 database:900 textmining:747
Rv3396c guaA GMP synthase 943 907 coexpression:895 textmining:418
Rv1379 pyrR bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase 989 900 database:900 textmining:895
Rv3310 sapM acid phosphatase 780 780 ctx neighborhood:780
Rv0070c glyA2 serine hydroxymethyltransferase 724 688 coexpression:662
Rv1093 glyA1 serine hydroxymethyltransferase 724 688 coexpression:662
Rv2890c rpsB 30S ribosomal protein S2 649 649 coexpression:648
Rv3311 hyp hypothetical protein 594 593 ctx neighborhood:592
Rv2889c tsf elongation factor EF-Ts 573 574 coexpression:572
Rv0700 rpsJ 30S ribosomal protein S10 538 538 coexpression:536
Rv1712 cmk cytidylate kinase 607 535 database:500

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: uracil phosphoribosyltransferase
  • MTBC0 PGAP product: uracil phosphoribosyltransferase
  • Pfam (hmmscan --cut_ga): UPRTase PF14681.13 (E=2e-66), Pribosyltran PF00156.34 (E=1e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217826.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UPRTase (PF14681.13), Pribosyltran (PF00156.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0035
  • Curated reference: UniProt P9WFF3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor rpiB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003517|Rv3309c|upp
MQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRDAPCEPVPIRTPLAETVGSRLTKPPLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPVPYLDSLPDDLTDVPVMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAAPEGIAALQKAAPNVRLFTAAIDEGLNEVAYIVPGLGDAGDRQFGPR