Rv3300c Family assigned · medium auto-curated
H37Rv Rv3300c · MTBC0 mtbc0_003508 ·
305 aa ·
3708063–3708980 MTBC0
(-) ·
RefSeq NP_217817.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | RluA family pseudouridine synthase |
| Revised (this work) | RluA family pseudouridine synthase. Pfam: PseudoU_synth_2 (PF00849.28). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -0.13 (95% CI -3.02 to 2.91). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|---|
| Mycobrowser EC |
5.4.99.-
· superseded EC numbering; the atlas uses the current class (5.4.99.28, 5.4.99.29)
|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number, COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3328c
· 99.3% identity |
|---|---|
| M. marinum |
MMAR_1231
· 78.8% identity |
| M. smegmatis |
MSMEG_1737
· 70.8% identity |
| M. orygis |
RJtmp_003400
· 99.7% identity |
| M. abscessus |
MAB_3654c
· 60.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O07166
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | RNA pseudouridylate synthase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rluA |
| eggNOG description | pseudouridine synthase |
| Orthologous group | COG0564 |
| EC number |
EC 5.4.99.28, EC 5.4.99.29
|
| KEGG orthology |
K06177
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 3.874 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 10 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.194 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 76.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 51.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 0.727, mean read count 68.875. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 3 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.36 ppm · rank 3388/3519 (3.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 305 aa |
|---|---|
| Molecular weight | 33.3 kDa |
| Theoretical pI | 9.9 |
| GRAVY | 0.015 (hydrophobic) |
| Aliphatic index | 105.1 |
| Aromaticity | 0.046 |
| Instability index | 35.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PseudoU_synth_2 | PF00849.28 | 1.4e-22 | 93–237 | RNA pseudouridylate synthase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 88.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2i82-assembly2_B |
1.00 | 0.80 | 2.3e-17 sig | 2i82-assembly2_B Crystal structure of pseudouridine synthase RluA: indirect sequence readout through protein-induced RNA structure |
1xpi-assembly2_B |
1.00 | 0.76 | 2.3e-15 sig | 1xpi-assembly2_B Crystal structure of the catalytic domain of E. coli pseudouridine synthase RluC |
1v9k-assembly2_B |
1.00 | 0.76 | 9.4e-15 sig | 1v9k-assembly2_B The crystal structure of the catalytic domain of pseudouridine synthase RluC from Escherichia coli |
1xpi-assembly1_A |
1.00 | 0.74 | 1.2e-14 sig | 1xpi-assembly1_A Crystal structure of the catalytic domain of E. coli pseudouridine synthase RluC |
1v9f-assembly1_A |
1.00 | 0.76 | 4.1e-14 sig | 1v9f-assembly1_A Crystal structure of catalytic domain of pseudouridine synthase RluD from Escherichia coli |
Foldseek search of the AlphaFold DB model (mean pLDDT 88.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | atsB (- strand, 19 bp gap) |
|---|---|
| Downstream (3' on genome) | phoY1 (- strand, 11 bp gap) |
| Predicted operon |
lpqC · atsB · Rv3300c · phoY1
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv2011c (represses) · Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: atsB (arylsulfatase AtsB), high confidence from genomic context alone (score 948 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3299c atsB |
arylsulfatase AtsB | 948 | 948 ctx | neighborhood:756 coexpression:796 |
Rv3301c phoY1 |
phosphate transport system transcriptional regulator PhoY | 943 | 843 ctx | neighborhood:792 textmining:656 |
Rv2420c rsfS hyp exp |
hypothetical protein | 843 | 829 | experimental:815 |
Rv2442c rplU exp |
50S ribosomal protein L21 | 826 | 826 | experimental:813 |
Rv3456c rplQ exp |
50S ribosomal protein L17 | 824 | 825 | experimental:813 |
Rv3443c rplM exp |
50S ribosomal protein L13 | 818 | 819 | experimental:806 |
Rv0723 rplO exp |
50S ribosomal protein L15 | 817 | 818 | experimental:806 |
Rv0640 rplK exp |
50S ribosomal protein L11 | 825 | 816 | experimental:809 |
Rv0701 rplC exp |
50S ribosomal protein L3 | 822 | 813 | experimental:804 |
Rv0714 rplN exp |
50S ribosomal protein L14 | 815 | 811 | experimental:803 |
Rv0715 rplX exp |
50S ribosomal protein L24 | 810 | 811 | experimental:803 |
Rv3302c glpD2 |
glycerol-3-phosphate dehydrogenase | 895 | 779 ctx | neighborhood:766 textmining:547 |
Rv3303c lpdA |
NAD(P)H quinone reductase LpdA | 870 | 779 ctx | neighborhood:759 textmining:437 |
Rv3262 fbiB |
coenzyme F420:L-glutamate ligase | 767 | 765 | coexpression:757 |
Rv1823 hyp |
hypothetical protein | 738 | 738 | coexpression:738 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: RluA family pseudouridine synthase
- Pfam (hmmscan --cut_ga): PseudoU_synth_2 PF00849.28 (E=1e-22)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217817.1)
- Domains: Pfam-A via hmmscan --cut_ga — PseudoU_synth_2 (PF00849.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0564 - Curated reference: UniProt O07166 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 88.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
74 functional partner(s); context anchor
atsB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003508|Rv3300c| MALRPEDRLLSVHDVLGPVRVRLLGGSVLAELTARFGVAARAKVLAGEVVDDDGAVVDSGTVLPPGSVVHLYRDLPDEVPVPFDVPVLHQDADIVVVDKPHFLATMPRGRHVAQTALVRLRRELGLPELSPAHRLDRLTAGVLLFTTRREVRGSYQTMFARGLVRKTYLARAPVAPGLALPRLVRSRIVKRRGHLQAVCEPGVPNAETLVERIARDGLYRLTPTTGRTHQLRVHMAALGIPIMGDPLYPNVISVAAHDFSTPLQLLAQRIEFDDPLTGSHREFASTRTLTGATLPTWSAAADCRP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3300c? Email the maintainer — the message is pre-filled with this gene's details.