Rv3300c Family assigned · medium auto-curated

H37Rv Rv3300c · MTBC0 mtbc0_003508 · 305 aa · 3708063–3708980 (-) · RefSeq NP_217817.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationRluA family pseudouridine synthase
Revised (this work)RluA family pseudouridine synthase. Pfam: PseudoU_synth_2 (PF00849.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07166 TrEMBL · unreviewed · Predicted
UniProt nameRNA pseudouridylate synthase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerluA
eggNOG descriptionpseudouridine synthase
Orthologous groupCOG0564
EC number EC 5.4.99.28, EC 5.4.99.29
KEGG orthology K06177

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 3.874 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 10 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PseudoU_synth_2PF00849.28 1.4e-2293–237 RNA pseudouridylate synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: atsB (arylsulfatase AtsB), high confidence from genomic context alone (score 948 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3299c atsB arylsulfatase AtsB 948 948 ctx neighborhood:756 coexpression:796
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 943 843 ctx neighborhood:792 textmining:656
Rv2420c rsfS hyp hypothetical protein 843 829 experimental:815
Rv2442c rplU 50S ribosomal protein L21 826 826 experimental:813
Rv3456c rplQ 50S ribosomal protein L17 824 825 experimental:813
Rv3443c rplM 50S ribosomal protein L13 818 819 experimental:806
Rv0723 rplO 50S ribosomal protein L15 817 818 experimental:806
Rv0640 rplK 50S ribosomal protein L11 825 816 experimental:809
Rv0701 rplC 50S ribosomal protein L3 822 813 experimental:804
Rv0714 rplN 50S ribosomal protein L14 815 811 experimental:803
Rv0715 rplX 50S ribosomal protein L24 810 811 experimental:803
Rv3302c glpD2 glycerol-3-phosphate dehydrogenase 895 779 ctx neighborhood:766 textmining:547
Rv3303c lpdA NAD(P)H quinone reductase LpdA 870 779 ctx neighborhood:759 textmining:437
Rv3262 fbiB coenzyme F420:L-glutamate ligase 767 765 coexpression:757
Rv1823 hyp hypothetical protein 738 738 coexpression:738

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: RluA family pseudouridine synthase
  • Pfam (hmmscan --cut_ga): PseudoU_synth_2 PF00849.28 (E=1e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217817.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PseudoU_synth_2 (PF00849.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0564
  • Curated reference: UniProt O07166 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 74 functional partner(s); context anchor atsB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003508|Rv3300c|
MALRPEDRLLSVHDVLGPVRVRLLGGSVLAELTARFGVAARAKVLAGEVVDDDGAVVDSGTVLPPGSVVHLYRDLPDEVPVPFDVPVLHQDADIVVVDKPHFLATMPRGRHVAQTALVRLRRELGLPELSPAHRLDRLTAGVLLFTTRREVRGSYQTMFARGLVRKTYLARAPVAPGLALPRLVRSRIVKRRGHLQAVCEPGVPNAETLVERIARDGLYRLTPTTGRTHQLRVHMAALGIPIMGDPLYPNVISVAAHDFSTPLQLLAQRIEFDDPLTGSHREFASTRTLTGATLPTWSAAADCRP