amiB1 Resolved · high auto-curated

H37Rv Rv3306c · MTBC0 - · 394 aa · 3692805–3693989 (-) · RefSeq YP_177956.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)amidase AmiB
MTBC0 PGAP re-annotation
Revised (this work)Amidase AmiB. Pfam: Peptidase_M20 (PF01546.34), M20_dimer (PF07687.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N690 TrEMBL · unreviewed · Evidence at protein level
UniProt namePeptidase M20 domain-containing protein 2

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameamiB1
eggNOG descriptionoverlaps another CDS with the same product name
Orthologous groupCOG1473

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.821 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_M20PF01546.34 2.3e-1187–344 Peptidase family M20/M25/M40
M20_dimerPF07687.20 4.5e-09170–260 Peptidase dimerisation domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: amiA1 (N-acyl-L-amino acid amidohydrolase AmiA), high confidence from genomic context alone (score 938 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3305c amiA1 N-acyl-L-amino acid amidohydrolase AmiA 977 938 ctx neighborhood:882 cooccurence:476 textmining:653
Rv3307 deoD purine nucleoside phosphorylase 791 789 ctx neighborhood:786
Rv3308 pmmB phosphomannomutase PmmB 788 788 ctx neighborhood:786
Rv1201c dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 492 456 coexpression:425
Rv0074 hyp hypothetical protein 438 416
Rv3304 hyp hypothetical protein 572 161 textmining:511
Rv3253c cationic amino acid transport integral membrane protein 536 85 textmining:514
Rv1477 ripA peptidoglycan endopeptidase RipA 465 77 textmining:445
Rv3375 amiD amidase 813 66 textmining:809
Rv2888c amiC amidase AmiC 873 65 textmining:870
Rv1478 ripB peptidoglycan endopeptidase RipB 445 64 textmining:432
Rv3915 cwlM peptidoglycan hydrolase 697 63 textmining:690
Rv3594 hyp hypothetical protein 571 55 textmining:565
Rv3717 hyp hypothetical protein 669 47 textmining:668
Rv3811 hyp hypothetical protein 532 47 textmining:530

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): amidase AmiB
  • Pfam (hmmscan --cut_ga): Peptidase_M20 PF01546.34 (E=2e-11), M20_dimer PF07687.20 (E=4e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177956.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_M20 (PF01546.34), M20_dimer (PF07687.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1473
  • Curated reference: UniProt L7N690 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor amiA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3306c|amiB1
MPAASASDRVEELVRRRGGELVELSHAIHAEPELAFAEHRSCAKAQALVAERGFEITTAAGGLDTAFRADYGSGPLVVGVCAEYDALPGIGHACGHNIIAASAVGTALALAEVADDLGLTVALLGTPAEESGGGKALMLQAGTFDDVAVAVMVHPGPTDIAGARSLALSEVTVRYRGKESHAAVAPHLGVNAADAVTVAQVAIGVLRQQLAPGQMVHGIVTDGGQAVNVIPGQARLQYAMRAVESDSLRELQTRMFACFAAGALAAGCEYEIDEAAPAYAELKPDPWLADVCREEMQRLGREPLLPALEAELPLGSTDMGNVTQVLPGIHPVIGLDAGAATVHQRAFTVASAGASADRAVVDGAIMLARTVVRLAQTPDERDRVLAAQQRRAAR