sapM Resolved · high auto-curated

H37Rv Rv3310 · MTBC0 mtbc0_003518 · 299 aa · 3719336–3720235 (+) · RefSeq NP_217827.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acid phosphatase
MTBC0 PGAP re-annotationphosphatidylinositol-3-phosphatase
Revised (this work)Phosphatidylinositol-3-phosphatase. Pfam: Phosphoesterase (PF04185.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53361 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphatidylinositol-3-phosphatase
EC (curated) EC 3.1.3.2, EC 3.1.3.64
Curated functionVirulence factor that plays an important role in blocking phagosome-lysosome fusion and thus participates in the intracellular survival of the pathogen. Acts as a phosphatase that dephosphorylates phosphatidylinositol 3-phosphate (PI3P), a membrane trafficking regulatory lipid essential for phagosomal acquisition of lysosomal constituents. Therefore, SapM eliminates PI3P from the phagosomal membrane by catalyzing its hydrolysis, and thus contributes to inhibition of phagosome maturation. Also interferes with autophagy: SapM blocks autophagosome-lysosome fusion in macrophages by binding to the .

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namesapM
eggNOG descriptionPhosphoesterase family
Orthologous groupCOG3511
EC number EC 3.1.3.64
KEGG orthology K21302
KEGG pathways map00562, map01100, map05152
Gene Ontology (86) GO:0003674, GO:0003824, GO:0003993, GO:0004438, GO:0004805, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0006139, GO:0006629, GO:0006644 +74 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.986 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PhosphoesterasePF04185.20 4.0e-5270–282 Phosphoesterase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: upp (uracil phosphoribosyltransferase), high confidence from genomic context alone (score 780 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2351c plcA membrane-associated phospholipase A 912 903 database:900
Rv2349c plcC phospholipase C 908 903 database:900
Rv1755c plcD Rv1755c, (MT1799, MTCY28.21c), len: 280 aa. Probable plcD, phospholipase C 4 (fragment) (see citations below),highly similar to C-terminus o 902 903 database:900
Rv2350c plcB membrane-associated phospholipase B 902 903 database:900
Rv3309c upp uracil phosphoribosyltransferase 780 780 ctx neighborhood:780
Rv3311 hyp hypothetical protein 817 779 ctx neighborhood:779
Rv0090 membrane protein 649 649 ctx cooccurence:649
Rv2963 integral membrane protein 645 645 ctx cooccurence:645
Rv0180c transmembrane protein 598 598 ctx cooccurence:591
Rv2638 hyp hypothetical protein 520 520 ctx cooccurence:520
Rv2612c pgsA1 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 499 500 database:500
Rv3199c nudC NADH pyrophosphatase 499 500 database:500
Rv1695 ppnK inorganic polyphosphate/ATP-NAD kinase 499 500 database:500
Rv1871c hyp hypothetical protein 488 488 ctx cooccurence:488
Rv3434c transmembrane protein 481 481 ctx cooccurence:481

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acid phosphatase
  • MTBC0 PGAP product: phosphatidylinositol-3-phosphatase
  • Pfam (hmmscan --cut_ga): Phosphoesterase PF04185.20 (E=4e-52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217827.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Phosphoesterase (PF04185.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3511
  • Curated reference: UniProt O53361 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor upp
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003518|Rv3310|sapM
MLRGIQALSRPLTRVYRALAVIGVLAASLLASWVGAVPQVGLAASALPTFAHVVIVVEENRSQAAIIGNKSAPFINSLAANGAMMAQAFAETHPSEPNYLALFAGNTFGLTKNTCPVNGGALPNLGSELLSAGYTFMGFAEDLPAVGSTVCSAGKYARKHVPWVNFSNVPATLSVPFSAFPKPQNYPGLPTVSFVIPNADNDMHDGSIAQGDAWLNRHLSAYANWAKTNNSLLVVTWDEDDGSSRNQIPTVFYGAHVRPGTYNETISHYNVLSTLEQIYGLPKTGYATNAPPITDIWGD