apt Resolved · high auto-curated
H37Rv Rv2584c · MTBC0 mtbc0_002751 ·
223 aa ·
2933773–2934444 MTBC0
(-) ·
RefSeq NP_217100.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | adenine phosphoribosyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | adenine phosphoribosyltransferase |
| Revised (this work) | Adenine phosphoribosyltransferase. Pfam: Pribosyltran (PF00156.34). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 56 publications
56 TB publications mention this gene. 56 publication(s) discuss this gene (52 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (4), M. abscessus (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Factors affecting the integration of tobacco cessation services for TB patients. doi:10.5588/ijtldopen.25.0587 | 2026 |
| Synthesis and Anti-Tubercular Activity of Novel Furan-Based Triazole-Acrylamide Hybrids: Experimental and Computational Insights. doi:10.1002/cbdv.202503298 | 2026 |
| Phytochemical analysis and antimicrobial, antioxidant, and cytotoxic activities of Scorzonera aucheriana DC (Asteraceae). doi:10.1016/j.fitote.2026.107088 | 2026 |
| Thyroid Tuberculosis: Misdiagnosed as Papillary Thyroid Carcinoma - A Rare Case Report. doi:10.2147/IMCRJ.S553344 | 2025 |
| Adenosine Deaminase and Systemic Immune Inflammatory Index-A Biomarker Duet Signature of Pulmonary Tuberculosis Severity. doi:10.3390/medicina61061096 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 18% of residues (metapredict) · mean AlphaFold pLDDT 85.5 |
|---|---|
| Disordered regions | 1 IDR(s), longest 39 aa [0-39] |
carries a substantial disordered region (39/223 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 0.78 (95% CI -0.64 to 2.33). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in purine salvage. Catalyses a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis [catalytic activity: AMP + pyrophosphate = adenine + 5-phospho-alpha-D-ribose 1-diphosphate]. |
|---|---|
| Mycobrowser EC |
2.4.2.7
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2615c
· 99.1% identity |
|---|---|
| M. marinum |
MMAR_2123
· 69.4% identity |
| M. smegmatis |
MSMEG_2964
· 70.8% identity |
| M. orygis |
RJtmp_002675
· 99.1% identity |
| M. abscessus |
MAB_2877c
· 67.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQ07
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Adenine phosphoribosyltransferase |
| EC (curated) |
EC 2.4.2.7
|
| Curated function | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | apt |
| eggNOG description | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis |
| Orthologous group | COG0503 |
| EC number |
EC 2.4.2.7
|
| KEGG orthology |
K00759
|
| KEGG pathways |
map00230, map01100
|
| Gene Ontology (50) |
GO:0003674, GO:0003824, GO:0003999, GO:0005575, GO:0005623, GO:0005886, GO:0006139, GO:0006144, GO:0006168, GO:0006725, GO:0006807, GO:0008150 +38 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.698 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
1.001 (low power)
· 7 consensus substitution(s) low power (7 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 69.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 54.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 188.166666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +1.27 | 0.014 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 124.0 ppm · rank 1146/3519 (67.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 223 aa |
|---|---|
| Molecular weight | 23.2 kDa |
| Theoretical pI | 9.5 |
| GRAVY | 0.25 (hydrophobic) |
| Aliphatic index | 112.0 |
| Aromaticity | 0.045 |
| Instability index | 37.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pribosyltran | PF00156.34 | 5.8e-15 | 87–202 | Phosphoribosyl transferase domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6fci-assembly1_A |
1.00 | 0.91 | 1.4e-21 sig | 6fci-assembly1_A Crystal Structure of Human APRT wild type in complex with Adenine, PRPP and Mg2+ |
6fd6-assembly1_B |
1.00 | 0.91 | 2.6e-21 sig | 6fd6-assembly1_B Crystal Structure of Human APRT-Tyr105Phe variant in complex with Adenine, PRPP and Mg2+, 30 days post crystallization (with AMP and PPi products fully generated) |
4m0k-assembly2_D |
1.00 | 0.92 | 1.1e-21 sig | 4m0k-assembly2_D Crystal structure of adenine phosphoribosyltransferase from Rhodothermus marinus DSM 4252, NYSGRC Target 029775. |
4x45-assembly1_A |
1.00 | 0.90 | 1.2e-21 sig | 4x45-assembly1_A Crystal Structure of F173G Mutant of Human APRT |
4lza-assembly1_B |
1.00 | 0.93 | 1.6e-20 sig | 4lza-assembly1_B Crystal structure of adenine phosphoribosyltransferase from Thermoanaerobacter pseudethanolicus ATCC 33223, NYSGRC Target 029700. |
Foldseek search of the AlphaFold DB model (mean pLDDT 85.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | relA (- strand, 30 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2585c (- strand, 103 bp gap) |
| Predicted operon |
relA · apt
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
phoP (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pnp (5'-methylthioadenosine phosphorylase), high confidence from genomic context alone (score 900 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3396c guaA exp |
GMP synthase | 996 | 992 | coexpression:872 database:900 textmining:554 |
Rv0777 purB exp |
adenylosuccinate lyase PurB | 979 | 963 | coexpression:402 database:900 textmining:485 |
Rv0957 purH exp |
bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase | 968 | 959 | coexpression:426 database:900 |
Rv1389 gmk exp |
guanylate kinase | 975 | 953 | coexpression:535 database:900 textmining:499 |
Rv3307 deoD exp |
purine nucleoside phosphorylase | 991 | 950 | database:938 textmining:831 |
Rv2202c adoK exp |
adenosine kinase | 963 | 948 | database:900 |
Rv0733 adk exp |
adenylate kinase | 961 | 940 | database:900 |
Rv3624c hpt exp |
hypoxanthine-guanine phosphoribosyltransferase | 993 | 917 | database:900 textmining:922 |
Rv0805 cpdA exp |
3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA | 912 | 906 | database:900 |
Rv3393 iunH exp |
nucleoside hydrolase | 982 | 903 | database:900 textmining:832 |
Rv0535 pnp exp |
5'-methylthioadenosine phosphorylase | 913 | 900 ctx | fusion:766 database:408 |
Rv2894c xerC |
tyrosine recombinase XerC | 853 | 853 | coexpression:853 |
Rv2587c secD |
protein translocase subunit SecD | 839 | 839 ctx | neighborhood:771 |
Rv1605 hisF exp |
imidazole glycerol phosphate synthase subunit HisF | 840 | 823 | database:800 |
Rv1602 hisH exp |
imidazole glycerol phosphate synthase subunit HisH | 811 | 812 | database:800 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: adenine phosphoribosyltransferase
- MTBC0 PGAP product: adenine phosphoribosyltransferase
- Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=6e-15)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217100.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0503 - Curated reference: UniProt P9WQ07 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
92 functional partner(s); context anchor
pnp - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002751|Rv2584c|apt MCHGGTWAGDYVLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASLTRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRASGADLVAGVDARGFLVAAAVATRLEVGVLAVRKGGKLPRPVLSEEYYREYGAATLEILAEGIEVAGRRVVIIDDVLATGGTIGATRRLLERGGANVAGAAVVVELAGLSGRAALAPLPVHSLSRL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for apt? Email the maintainer — the message is pre-filled with this gene's details.