apt Resolved · high auto-curated

H37Rv Rv2584c · MTBC0 mtbc0_002751 · 223 aa · 2933773–2934444 (-) · RefSeq NP_217100.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)adenine phosphoribosyltransferase
MTBC0 PGAP re-annotationadenine phosphoribosyltransferase
Revised (this work)Adenine phosphoribosyltransferase. Pfam: Pribosyltran (PF00156.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQ07 SwissProt · reviewed · Evidence at protein level
UniProt nameAdenine phosphoribosyltransferase
EC (curated) EC 2.4.2.7
Curated functionCatalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nameapt
eggNOG descriptionCatalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis
Orthologous groupCOG0503
EC number EC 2.4.2.7
KEGG orthology K00759
KEGG pathways map00230, map01100
Gene Ontology (50) GO:0003674, GO:0003824, GO:0003999, GO:0005575, GO:0005623, GO:0005886, GO:0006139, GO:0006144, GO:0006168, GO:0006725, GO:0006807, GO:0008150 +38 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.698 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PribosyltranPF00156.34 5.8e-1587–202 Phosphoribosyl transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pnp (5'-methylthioadenosine phosphorylase), high confidence from genomic context alone (score 900 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3396c guaA GMP synthase 996 992 coexpression:872 database:900 textmining:554
Rv0777 purB adenylosuccinate lyase PurB 979 963 coexpression:402 database:900 textmining:485
Rv0957 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase 968 959 coexpression:426 database:900
Rv1389 gmk guanylate kinase 975 953 coexpression:535 database:900 textmining:499
Rv3307 deoD purine nucleoside phosphorylase 991 950 database:938 textmining:831
Rv2202c adoK adenosine kinase 963 948 database:900
Rv0733 adk adenylate kinase 961 940 database:900
Rv3624c hpt hypoxanthine-guanine phosphoribosyltransferase 993 917 database:900 textmining:922
Rv0805 cpdA 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA 912 906 database:900
Rv3393 iunH nucleoside hydrolase 982 903 database:900 textmining:832
Rv0535 pnp 5'-methylthioadenosine phosphorylase 913 900 ctx fusion:766 database:408
Rv2894c xerC tyrosine recombinase XerC 853 853 coexpression:853
Rv2587c secD protein translocase subunit SecD 839 839 ctx neighborhood:771
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 840 823 database:800
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 811 812 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: adenine phosphoribosyltransferase
  • MTBC0 PGAP product: adenine phosphoribosyltransferase
  • Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=6e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217100.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0503
  • Curated reference: UniProt P9WQ07 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 92 functional partner(s); context anchor pnp
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002751|Rv2584c|apt
MCHGGTWAGDYVLNVIATGLSLKARGKRRRQRWVDDGRVLALGESRRSSAISVADVVASLTRDVADFPVPGVEFKDLTPLFADRRGLAAVTEALADRASGADLVAGVDARGFLVAAAVATRLEVGVLAVRKGGKLPRPVLSEEYYREYGAATLEILAEGIEVAGRRVVIIDDVLATGGTIGATRRLLERGGANVAGAAVVVELAGLSGRAALAPLPVHSLSRL