add Resolved · high auto-curated

H37Rv Rv3313c · MTBC0 mtbc0_003523 · 365 aa · 3723225–3724322 (-) · RefSeq NP_217830.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)adenosine deaminase
MTBC0 PGAP re-annotationadenosine deaminase
Revised (this work)Adenosine deaminase. Pfam: A_deaminase (PF00962.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P63907 SwissProt · reviewed · Evidence at protein level
UniProt nameAdenosine deaminase
EC (curated) EC 3.5.4.4
Curated functionCatalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nameadd
eggNOG descriptionadenosine deaminase
Orthologous groupCOG1816
EC number EC 3.5.4.4
KEGG orthology K01488
KEGG pathways map00230, map01100, map05340
Gene Ontology (91) GO:0003674, GO:0003824, GO:0004000, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006144, GO:0006152, GO:0006154 +79 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.168 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
A_deaminasePF00962.29 1.9e-13114–354 Adenosine deaminase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: deoA (thymidine phosphorylase), high confidence from genomic context alone (score 920 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3307 deoD purine nucleoside phosphorylase 953 938 database:922
Rv3314c deoA thymidine phosphorylase 989 920 ctx neighborhood:882 textmining:870
Rv3315c cdd cytidine deaminase 976 915 ctx neighborhood:881 textmining:731
Rv2202c adoK adenosine kinase 991 914 database:900 textmining:901
Rv3393 iunH nucleoside hydrolase 918 910 database:900
Rv3316 sdhC succinate dehydrogenase cytochrome B-556 subunit 779 779 ctx neighborhood:746
Rv3317 sdhD succinate dehydrogenase hydrophobic membrane anchor subunit 749 749 ctx neighborhood:746
Rv3319 sdhB succinate dehydrogenase iron-sulphur protein subunit 691 691 ctx neighborhood:677
Rv3318 sdhA succinate dehydrogenase flavoprotein subunit 688 688 ctx neighborhood:677
Rv3312A mtp pilin 628 629 ctx neighborhood:624
Rv2584c apt adenine phosphoribosyltransferase 767 539 experimental:405 textmining:517
Rv3000 transmembrane protein 521 522 ctx neighborhood:520
Rv3396c guaA GMP synthase 732 468 textmining:518
Rv1469 ctpD cobalt/nickel-exporting P-type ATPase 463 463 coexpression:462
Rv1021 mazG nucleoside triphosphate pyrophosphohydrolase 430 430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: adenosine deaminase
  • MTBC0 PGAP product: adenosine deaminase
  • Pfam (hmmscan --cut_ga): A_deaminase PF00962.29 (E=2e-131)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217830.1)
  • Domains: Pfam-A via hmmscan --cut_ga — A_deaminase (PF00962.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1816
  • Curated reference: UniProt P63907 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor deoA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003523|Rv3313c|add
MTAAPTLQTIRLAPKALLHDHLDGGLRPATVLDIAGQVGYDDLPATDVDALASWFRTQSHSGSLERYLEPFSHTVAVMQTPEALYRVAFECAQDLAADSVVYAEVRFAPELHISCGLSFDDVVDTVLTGFAAGEKACAADGQPITVRCLVTAMRHAAMSREIAELAIRFRDKGVVGFDIAGAEAGHPPTRHLDAFEYMRDHNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDVDADGGFQLGRLAAILRDKRIPLELCPSSNVQTGAVASIAEHPFDLLARARFRVTVNTDNRLMSDTSMSLEMHRLVEAFGYGWSDLARFTVNAMKSAFIPFDQRLAIIDEVIKPRFAALMGHSE