add Resolved · high auto-curated
H37Rv Rv3313c · MTBC0 mtbc0_003523 ·
365 aa ·
3723225–3724322 MTBC0
(-) ·
RefSeq NP_217830.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | adenosine deaminase |
|---|---|
| MTBC0 PGAP re-annotation | adenosine deaminase |
| Revised (this work) | Adenosine deaminase. Pfam: A_deaminase (PF00962.29). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 600 publications
600 TB publications mention this gene. 600 publication(s) discuss this gene (477 in a M. tuberculosis context, 59 in other mycobacteria — M. smegmatis (19), M. abscessus (12), M. leprae (9), M. marinum (2)).
| Publication | Date |
|---|---|
| Diagnostic accuracy of the Fujifilm SILVAMP TB LAM II (FujiLAM II) assay for the diagnosis of childhood tuberculosis. doi:10.1186/s12879-026-13992-2 | 2026 |
| Simulation and virtual reality applications in medical training for tuberculosis diagnosis. doi:10.1016/j.ijtb.2026.02.036 | 2026 |
| Impact of online community learning programs on TB prevention behaviors. doi:10.1016/j.ijtb.2026.02.034 | 2026 |
| Comorbidities, health-related quality of life and its associated factors among people living with HIV/AIDS in Gandaki Province of Nepal. doi:10.1186/s12889-026-28192-5 | 2026 |
| Retraction of P-1395. Comparative Analysis of Sensitivity and Add-On Value of Xpert and Xpert Ultra in Diagnosing Pulmonary Tuberculosis and Stool Samples of Children in Indian. doi:10.1093/ofid/ofag308 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | deoA (Rv3314c, - strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
SigH (sigH).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.13 (95% CI -4.84 to 6.12). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Catalyzes hydrolytic deamination of adenosine and generates inosine [catalytic activity: adenosine + H(2)O = inosine + NH(3) (also may act on deoxyadenosine)]. |
|---|---|
| Mycobrowser EC |
3.5.4.4
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3342c
· 100.0% identity |
|---|---|
| M. leprae |
ML0700
· 88.2% identity |
| M. marinum |
MMAR_1206
· 86.2% identity |
| M. smegmatis |
MSMEG_1676
· 83.7% identity |
| M. orygis |
RJtmp_003415
· 100.0% identity |
| M. abscessus |
MAB_3670c
· 76.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P63907
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Adenosine deaminase |
| EC (curated) |
EC 3.5.4.4
|
| Curated function | Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | add |
| eggNOG description | adenosine deaminase |
| Orthologous group | COG1816 |
| EC number |
EC 3.5.4.4
|
| KEGG orthology |
K01488
|
| KEGG pathways |
map00230, map01100, map05340
|
| Gene Ontology (91) |
GO:0003674, GO:0003824, GO:0004000, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006144, GO:0006152, GO:0006154 +79 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.168 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 65.9% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 0.923, mean read count 31.75. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -3.11 | 0.02 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 13 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 93.5 ppm · rank 1340/3519 (61.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 365 aa |
|---|---|
| Molecular weight | 39.7 kDa |
| Theoretical pI | 5.34 |
| GRAVY | 0.056 (hydrophobic) |
| Aliphatic index | 91.5 |
| Aromaticity | 0.077 |
| Instability index | 33.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
A_deaminase | PF00962.29 | 1.9e-131 | 14–354 | Adenosine deaminase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1fkw-assembly1_A |
1.00 | 0.88 | 9.7e-24 sig | 1fkw-assembly1_A MURINE ADENOSINE DEAMINASE (D295E) |
1fkx-assembly1_A |
1.00 | 0.89 | 5.9e-23 sig | 1fkx-assembly1_A MURINE ADENOSINE DEAMINASE (D296A) |
1uio-assembly1_A |
1.00 | 0.88 | 1.1e-22 sig | 1uio-assembly1_A ADENOSINE DEAMINASE (HIS 238 ALA MUTANT) |
3km8-assembly2_B |
1.00 | 0.88 | 6.2e-22 sig | 3km8-assembly2_B Crystal structuore of adenosine deaminase from mus musculus complexed with 9-deazainosine |
1uip-assembly1_A |
1.00 | 0.88 | 1.0e-21 sig | 1uip-assembly1_A ADENOSINE DEAMINASE (HIS 238 GLU MUTANT) |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv3312A (- strand, 70 bp gap) |
|---|---|
| Downstream (3' on genome) | deoA (- strand, -1 bp gap) |
| Predicted operon |
add · deoA · cdd
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: deoA (thymidine phosphorylase), high confidence from genomic context alone (score 920 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3307 deoD exp |
purine nucleoside phosphorylase | 953 | 938 | database:922 |
Rv3314c deoA |
thymidine phosphorylase | 989 | 920 ctx | neighborhood:882 textmining:870 |
Rv3315c cdd |
cytidine deaminase | 976 | 915 ctx | neighborhood:881 textmining:731 |
Rv2202c adoK exp |
adenosine kinase | 991 | 914 | database:900 textmining:901 |
Rv3393 iunH exp |
nucleoside hydrolase | 918 | 910 | database:900 |
Rv3316 sdhC |
succinate dehydrogenase cytochrome B-556 subunit | 779 | 779 ctx | neighborhood:746 |
Rv3317 sdhD |
succinate dehydrogenase hydrophobic membrane anchor subunit | 749 | 749 ctx | neighborhood:746 |
Rv3319 sdhB |
succinate dehydrogenase iron-sulphur protein subunit | 691 | 691 ctx | neighborhood:677 |
Rv3318 sdhA |
succinate dehydrogenase flavoprotein subunit | 688 | 688 ctx | neighborhood:677 |
Rv3312A mtp |
pilin | 628 | 629 ctx | neighborhood:624 |
Rv2584c apt exp |
adenine phosphoribosyltransferase | 767 | 539 | experimental:405 textmining:517 |
Rv3000 |
transmembrane protein | 521 | 522 ctx | neighborhood:520 |
Rv3396c guaA |
GMP synthase | 732 | 468 | textmining:518 |
Rv1469 ctpD |
cobalt/nickel-exporting P-type ATPase | 463 | 463 | coexpression:462 |
Rv1021 mazG |
nucleoside triphosphate pyrophosphohydrolase | 430 | 430 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: adenosine deaminase
- MTBC0 PGAP product: adenosine deaminase
- Pfam (hmmscan --cut_ga): A_deaminase PF00962.29 (E=2e-131)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217830.1)
- Domains: Pfam-A via hmmscan --cut_ga — A_deaminase (PF00962.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1816 - Curated reference: UniProt P63907 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
37 functional partner(s); context anchor
deoA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003523|Rv3313c|add MTAAPTLQTIRLAPKALLHDHLDGGLRPATVLDIAGQVGYDDLPATDVDALASWFRTQSHSGSLERYLEPFSHTVAVMQTPEALYRVAFECAQDLAADSVVYAEVRFAPELHISCGLSFDDVVDTVLTGFAAGEKACAADGQPITVRCLVTAMRHAAMSREIAELAIRFRDKGVVGFDIAGAEAGHPPTRHLDAFEYMRDHNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDVDADGGFQLGRLAAILRDKRIPLELCPSSNVQTGAVASIAEHPFDLLARARFRVTVNTDNRLMSDTSMSLEMHRLVEAFGYGWSDLARFTVNAMKSAFIPFDQRLAIIDEVIKPRFAALMGHSE
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for add? Email the maintainer — the message is pre-filled with this gene's details.