pncB2 Resolved · high auto-curated
H37Rv Rv0573c · MTBC0 mtbc0_000603 ·
463 aa ·
669402–670793 MTBC0
(-) ·
RefSeq NP_215087.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | nicotinic acid phosphoribosyltransferase PncB2 |
|---|---|
| MTBC0 PGAP re-annotation | nicotinate phosphoribosyltransferase |
| Revised (this work) | Nicotinate phosphoribosyltransferase. Pfam: NAPRTase_N (PF17767.8), NAPRTase (PF04095.23). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Novel Mutations in Putative Nicotinic Acid Phosphoribosyltransferases of Mycobacterium tuberculosis and Their Effect on Protein Thermodynamic Properties. doi:10.3390/polym14081623 | 2022 |
| Biosynthesis and recycling of nicotinamide cofactors in mycobacterium tuberculosis. An essential role for NAD in nonreplicating bacilli. doi:10.1074/jbc.M800694200 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
DevR-2 (devR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
Post-translational modifications
1 reported modified residue(s), incl. 1 phosphosite(s):
Phosphohistidine @202.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index 1.12 (95% CI -0.51 to 3.79). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in NAD salvage. Phosphoribosylation of nicotinic acid. [catalytic activity: nicotinate + 5-phosphoribosyl 1-pyrophosphate = nicotinate mononucleotide + diphosphate] |
|---|---|
| Mycobrowser EC |
2.4.2.11
· differs from the atlas (6.3.4.21) — nicotinate phosphoribosyltransferase: EC 2.4.2.11 was reclassified to 6.3.4.21 (ATP-dependent)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0588c
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_000602
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJI7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Nicotinate phosphoribosyltransferase pncB2 |
| EC (curated) |
EC 6.3.4.21
|
| Curated function | Involved in the Preiss-Handler pathway, which is a recycling route that permits the salvage of free nicotinamide (NM) and nicotinic acid (Na) involved in the NAD biosynthesis. Catalyzes the synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate at the expense of ATP. It is not able to use nicotinamide. PncB2 appears to be responsible for the increased salvage synthesis of NAD during infection of host tissues. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| eggNOG description | Catalyzes the synthesis of beta-nicotinate D- ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate at the expense of ATP |
| Orthologous group | COG1488 |
| EC number |
EC 6.3.4.21
|
| KEGG orthology |
K00763
|
| KEGG pathways |
map00760, map01100
|
| Gene Ontology (79) |
GO:0001666, GO:0003674, GO:0003824, GO:0004516, GO:0005575, GO:0005623, GO:0005886, GO:0006139, GO:0006725, GO:0006732, GO:0006733, GO:0006753 +67 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.513 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 45.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 40.4% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 0.941, mean read count 101.8125. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 6.17 ppm · rank 2866/3519 (18.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 463 aa |
|---|---|
| Molecular weight | 50.5 kDa |
| Theoretical pI | 6.24 |
| GRAVY | -0.03 (hydrophilic) |
| Aliphatic index | 91.7 |
| Aromaticity | 0.089 |
| Instability index | 32.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NAPRTase_N | PF17767.8 | 1.8e-35 | 10–132 | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain |
NAPRTase | PF04095.23 | 7.9e-12 | 154–329 | Nicotinate phosphoribosyltransferase (NAPRTase) family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4mzy-assembly1_A |
1.00 | 0.91 | 3.2e-44 sig | 4mzy-assembly1_A Crystal structure of enterococcus faecalis nicotinate phosphoribosyltransferase with malonate and phosphate bound |
4yub-assembly1_A |
1.00 | 0.82 | 3.7e-31 sig | 4yub-assembly1_A Crystal structure of human Nicotinic Acid Phosphoribosyltransferase |
4yub-assembly1_B |
1.00 | 0.81 | 1.3e-30 sig | 4yub-assembly1_B Crystal structure of human Nicotinic Acid Phosphoribosyltransferase |
2i14-assembly1_E |
1.00 | 0.84 | 1.2e-26 sig | 2i14-assembly1_E Crystal structure of nicotinate-nucleotide pyrophosphorylase from Pyrococcus furiosus |
2i1o-assembly1_A |
1.00 | 0.84 | 9.0e-25 sig | 2i1o-assembly1_A Crystal Structure of a Nicotinate Phosphoribosyltransferase from Thermoplasma acidophilum |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv0572c (- strand, 467 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0574c (- strand, 9 bp gap) |
| Predicted operon |
pncB2 · Rv0574c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pncA (pyrazinamidase/nicotinamidase PncA), high confidence from genomic context alone (score 977 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2043c pncA exp |
pyrazinamidase/nicotinamidase PncA | 987 | 977 ctx | fusion:410 cooccurence:572 database:900 textmining:475 |
Rv0574c hyp |
hypothetical protein | 975 | 975 ctx | neighborhood:801 coexpression:860 |
Rv1596 nadC exp |
nicotinate-nucleotide pyrophosphatase | 967 | 931 | database:900 textmining:543 |
Rv1330c pncB1 exp |
nicotinic acid phosphoribosyltransferase PncB1 | 926 | 920 | database:900 |
Rv1901 cinA exp |
competence damage-inducible protein CinA | 960 | 919 | database:900 textmining:532 |
Rv0212c nadR exp |
transcriptional regulator NadR | 948 | 916 | database:900 textmining:416 |
Rv2421c nadD exp |
nicotinate-nucleotide adenylyltransferase | 952 | 909 | database:900 textmining:493 |
Rv3199c nudC exp |
NADH pyrophosphatase | 939 | 905 | database:900 |
Rv3307 deoD exp |
purine nucleoside phosphorylase | 909 | 904 | database:900 |
Rv1997 ctpF |
cation transporter ATPase F | 758 | 759 | coexpression:751 |
Rv0575c |
oxidoreductase | 577 | 552 ctx | neighborhood:470 |
Rv2003c hyp |
hypothetical protein | 553 | 549 | coexpression:474 |
Rv2004c hyp |
hypothetical protein | 492 | 492 | |
Rv2438c nadE |
glutamine-dependent NAD(+) synthetase | 717 | 489 | coexpression:415 textmining:469 |
Rv2624c |
universal stress protein | 403 | 401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: nicotinic acid phosphoribosyltransferase PncB2
- MTBC0 PGAP product: nicotinate phosphoribosyltransferase
- Pfam (hmmscan --cut_ga): NAPRTase_N PF17767.8 (E=2e-35), NAPRTase PF04095.23 (E=8e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215087.1)
- Domains: Pfam-A via hmmscan --cut_ga — NAPRTase_N (PF17767.8), NAPRTase (PF04095.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1488 - Curated reference: UniProt P9WJI7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
pncA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000603|Rv0573c|pncB2 MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGRSYIMAAGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTVIFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAHGTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLYPATMLLVDTYDTLRGVDHVIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLEQVEIFASSGLDENRIAALLAARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTKFSSGKVIYPGRKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLDGARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGAKAKRP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pncB2? Email the maintainer — the message is pre-filled with this gene's details.