cdd Resolved · high auto-curated
H37Rv Rv3315c · MTBC0 mtbc0_003525 ·
133 aa ·
3725602–3726003 MTBC0
(-) ·
RefSeq NP_217832.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cytidine deaminase |
|---|---|
| MTBC0 PGAP re-annotation | cytidine deaminase |
| Revised (this work) | Cytidine deaminase. Pfam: dCMP_cyt_deam_2 (PF08211.19), dCMP_cyt_deam_1 (PF00383.30). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 9 publications
9 TB publications mention this gene. 9 publication(s) discuss this gene (9 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Construction of Mycobacterium tuberculosis cdd knockout and evaluation of invasion and growth in macrophages. doi:10.1590/0074-02760170105 | 2017 |
| Collaborative drug discovery for More Medicines for Tuberculosis (MM4TB). doi:10.1016/j.drudis.2016.10.009 | 2017 |
| The Collaborative Drug Discovery (CDD) database. doi:10.1007/978-1-62703-342-8_10 | 2013 |
| TB Mobile: a mobile app for anti-tuberculosis molecules with known targets. doi:10.1186/1758-2946-5-13 | 2013 |
| MycPermCheck: the Mycobacterium tuberculosis permeability prediction tool for small molecules. doi:10.1093/bioinformatics/bts641 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | deoA (Rv3314c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.55 (95% CI -0.92 to 2.41). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | This enzyme scavenge exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis [catalytic activity: cytidine + H(2)O = uridine + NH(3)]. |
|---|---|
| Mycobrowser EC |
3.5.4.5
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3344c
· 100.0% identity |
|---|---|
| M. leprae |
ML2174
· 56.8% identity |
| M. marinum |
MMAR_1204
· 79.4% identity |
| M. smegmatis |
MSMEG_1673
· 74.8% identity |
| M. orygis |
RJtmp_003417
· 100.0% identity |
| M. abscessus |
MAB_3672c
· 70.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WPH3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Cytidine deaminase |
| EC (curated) |
EC 3.5.4.5
|
| Curated function | Recycles cytidine and 2-deoxycytidine for uridine and 2-deoxyuridine synthesis, respectively. Catalyzes the hydrolytic deamination of cytidine and 2-deoxycytidine to form, respectively, uridine and 2-deoxyuridine. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | cdd |
| eggNOG description | cytidine deaminase |
| Orthologous group | COG0295 |
| EC number |
EC 3.5.4.5
|
| KEGG orthology |
K01489
|
| KEGG pathways |
map00240, map00983, map01100
|
| Gene Ontology (95) |
GO:0003674, GO:0003824, GO:0004126, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006139, GO:0006206 +83 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 78.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 57.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 58. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 144.0 ppm · rank 1034/3519 (70.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 133 aa |
|---|---|
| Molecular weight | 14.1 kDa |
| Theoretical pI | 5.72 |
| GRAVY | 0.135 (hydrophobic) |
| Aliphatic index | 97.5 |
| Aromaticity | 0.045 |
| Instability index | 32.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
dCMP_cyt_deam_2 | PF08211.19 | 1.7e-06 | 8–61 | Cytidine and deoxycytidylate deaminase zinc-binding region |
dCMP_cyt_deam_1 | PF00383.30 | 5.0e-13 | 13–101 | Cytidine and deoxycytidylate deaminase zinc-binding region |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4wig |
X-ray diffraction | 1.758 Å | 100% |
4wif |
X-ray diffraction | 1.8 Å | 100% |
3ijf |
X-ray diffraction | 1.99 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4wig-assembly1_A |
1.00 | 1.00 | 3.1e-26 sig | 4wig-assembly1_A Crystal structure of E47D mutant cytidine deaminase from Mycobacterium tuberculosis (MtCDA E47D) |
4wif-assembly1_A |
1.00 | 1.00 | 4.8e-26 sig | 4wif-assembly1_A Crystal structure of E47Q mutant cytidine deaminase from Mycobacterium tuberculosis (MtCDA E47Q) |
3ijf-assembly1_X |
1.00 | 0.99 | 2.7e-26 sig | 3ijf-assembly1_X Crystal structure of cytidine deaminase from Mycobacterium tuberculosis |
4f3w-assembly1_C |
1.00 | 0.99 | 3.9e-22 sig | 4f3w-assembly1_C Crystal structure of cytidine deaminase Cdd from Mycobacterium marinum |
3mpz-assembly1_B |
1.00 | 0.99 | 1.3e-20 sig | 3mpz-assembly1_B Crystal structure of CYTIDINE DEAMINASE from Mycobacterium smegmatis |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | deoA (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | sdhC (+ strand, 236 bp gap) |
| Predicted operon |
add · deoA · cdd
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: deoA (thymidine phosphorylase), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3314c deoA exp |
thymidine phosphorylase | 999 | 999 ctx | neighborhood:881 fusion:530 cooccurence:750 coexpression:431 database:900 textmining:885 |
Rv3307 deoD exp |
purine nucleoside phosphorylase | 971 | 971 ctx | cooccurence:600 database:924 |
Rv3313c add |
adenosine deaminase | 976 | 915 ctx | neighborhood:881 textmining:731 |
Rv3316 sdhC |
succinate dehydrogenase cytochrome B-556 subunit | 753 | 754 ctx | neighborhood:746 |
Rv3317 sdhD |
succinate dehydrogenase hydrophobic membrane anchor subunit | 751 | 751 ctx | neighborhood:746 |
Rv0478 deoC |
2-deoxyribose-5-phosphate aldolase | 765 | 734 ctx | cooccurence:590 |
Rv3318 sdhA |
succinate dehydrogenase flavoprotein subunit | 680 | 680 ctx | neighborhood:677 |
Rv3319 sdhB |
succinate dehydrogenase iron-sulphur protein subunit | 679 | 679 ctx | neighborhood:677 |
Rv2357c glyS |
glycine--tRNA ligase | 650 | 651 | coexpression:631 |
Rv3312A mtp |
pilin | 643 | 601 ctx | neighborhood:597 |
Rv3393 iunH exp |
nucleoside hydrolase | 620 | 575 | database:500 |
Rv2438c nadE exp |
glutamine-dependent NAD(+) synthetase | 591 | 572 | database:522 |
Rv3339c icd1 exp |
isocitrate dehydrogenase | 557 | 557 | database:553 |
Rv0480c exp |
amidohydrolase | 576 | 556 | database:522 |
Rv2364c era |
GTPase Era | 559 | 556 | coexpression:514 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cytidine deaminase
- MTBC0 PGAP product: cytidine deaminase
- Pfam (hmmscan --cut_ga): dCMP_cyt_deam_2 PF08211.19 (E=2e-06), dCMP_cyt_deam_1 PF00383.30 (E=5e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217832.1)
- Domains: Pfam-A via hmmscan --cut_ga — dCMP_cyt_deam_2 (PF08211.19), dCMP_cyt_deam_1 (PF00383.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0295 - Curated reference: UniProt P9WPH3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
deoA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003525|Rv3315c|cdd MPDVDWNMLRGNATQAAAGAYVPYSRFAVGAAALVDDGRVVTGCNVENVSYGLTLCAECAVVCALHSTGGGRLLALACVDGHGSVLMPCGRCRQVLLEHGGSELLIDHPVRPRRLGDLLPDAFGLDDLPRERR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cdd? Email the maintainer — the message is pre-filled with this gene's details.