cdd Resolved · high auto-curated

H37Rv Rv3315c · MTBC0 mtbc0_003525 · 133 aa · 3725602–3726003 (-) · RefSeq NP_217832.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cytidine deaminase
MTBC0 PGAP re-annotationcytidine deaminase
Revised (this work)Cytidine deaminase. Pfam: dCMP_cyt_deam_2 (PF08211.19), dCMP_cyt_deam_1 (PF00383.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPH3 SwissProt · reviewed · Evidence at protein level
UniProt nameCytidine deaminase
EC (curated) EC 3.5.4.5
Curated functionRecycles cytidine and 2-deoxycytidine for uridine and 2-deoxyuridine synthesis, respectively. Catalyzes the hydrolytic deamination of cytidine and 2-deoxycytidine to form, respectively, uridine and 2-deoxyuridine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namecdd
eggNOG descriptioncytidine deaminase
Orthologous groupCOG0295
EC number EC 3.5.4.5
KEGG orthology K01489
KEGG pathways map00240, map00983, map01100
Gene Ontology (95) GO:0003674, GO:0003824, GO:0004126, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006139, GO:0006206 +83 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
dCMP_cyt_deam_2PF08211.19 1.7e-068–61 Cytidine and deoxycytidylate deaminase zinc-binding region
dCMP_cyt_deam_1PF00383.30 5.0e-1313–101 Cytidine and deoxycytidylate deaminase zinc-binding region

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: deoA (thymidine phosphorylase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3314c deoA thymidine phosphorylase 999 999 ctx neighborhood:881 fusion:530 cooccurence:750 coexpression:431 database:900 textmining:885
Rv3307 deoD purine nucleoside phosphorylase 971 971 ctx cooccurence:600 database:924
Rv3313c add adenosine deaminase 976 915 ctx neighborhood:881 textmining:731
Rv3316 sdhC succinate dehydrogenase cytochrome B-556 subunit 753 754 ctx neighborhood:746
Rv3317 sdhD succinate dehydrogenase hydrophobic membrane anchor subunit 751 751 ctx neighborhood:746
Rv0478 deoC 2-deoxyribose-5-phosphate aldolase 765 734 ctx cooccurence:590
Rv3318 sdhA succinate dehydrogenase flavoprotein subunit 680 680 ctx neighborhood:677
Rv3319 sdhB succinate dehydrogenase iron-sulphur protein subunit 679 679 ctx neighborhood:677
Rv2357c glyS glycine--tRNA ligase 650 651 coexpression:631
Rv3312A mtp pilin 643 601 ctx neighborhood:597
Rv3393 iunH nucleoside hydrolase 620 575 database:500
Rv2438c nadE glutamine-dependent NAD(+) synthetase 591 572 database:522
Rv3339c icd1 isocitrate dehydrogenase 557 557 database:553
Rv0480c amidohydrolase 576 556 database:522
Rv2364c era GTPase Era 559 556 coexpression:514

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cytidine deaminase
  • MTBC0 PGAP product: cytidine deaminase
  • Pfam (hmmscan --cut_ga): dCMP_cyt_deam_2 PF08211.19 (E=2e-06), dCMP_cyt_deam_1 PF00383.30 (E=5e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217832.1)
  • Domains: Pfam-A via hmmscan --cut_ga — dCMP_cyt_deam_2 (PF08211.19), dCMP_cyt_deam_1 (PF00383.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0295
  • Curated reference: UniProt P9WPH3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor deoA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003525|Rv3315c|cdd
MPDVDWNMLRGNATQAAAGAYVPYSRFAVGAAALVDDGRVVTGCNVENVSYGLTLCAECAVVCALHSTGGGRLLALACVDGHGSVLMPCGRCRQVLLEHGGSELLIDHPVRPRRLGDLLPDAFGLDDLPRERR