Rv3098A Family assigned · medium auto-curated

H37Rv Rv3098A · MTBC0 - · 106 aa · 3467606–3467926 (+) · RefSeq YP_007411812.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PemK-like protein
MTBC0 PGAP re-annotation
Revised (this work)PemK-like protein. Pfam: PemK_toxin (PF02452.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt V5QRX7 SwissProt · reviewed · Evidence at protein level
UniProt namePutative toxin Rv3098A/RVBD_3098A
Curated functionPutative toxic component of a possible type II toxin-antitoxin (TA) system. Its toxic effect may be neutralized by cognate antitoxin Rv3098B/RVBD_3098B.

UniProt still lists this protein as Putative toxin Rv3098A/RVBD_3098A; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionPemK-like, MazF-like toxin of type II toxin-antitoxin system
Orthologous groupCOG2337
KEGG orthology K07171

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PemK_toxinPF02452.24 5.6e-164–103 PemK-like, MazF-like toxin of type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC3 (ribonuclease VapC3), high confidence from genomic context alone (score 761 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0549c vapC3 ribonuclease VapC3 769 761 ctx cooccurence:761
Rv0960 vapC9 ribonuclease VapC9 762 754 ctx cooccurence:753
Rv1720c vapC12 ribonuclease VapC12 753 745 ctx cooccurence:744
Rv0065 vapC1 ribonuclease VapC1 748 740 ctx cooccurence:739
Rv2801A mazE9 antitoxin MazE9 676 672 ctx cooccurence:528
Rv3180c vapC49 ribonuclease VapC45 660 660 ctx cooccurence:659
Rv3407 vapB47 antitoxin VapB47 614 615 ctx cooccurence:614
Rv1991A mazE6 antitoxin MazE6 630 607 experimental:434
Rv3098c hyp hypothetical protein 572 572 ctx neighborhood:572
Rv0582 vapC26 ribonuclease VapC26 564 564 ctx cooccurence:564
Rv3384c vapC46 ribonuclease VapC46 562 546 ctx cooccurence:545
Rv2018 vapB45 hyp hypothetical protein 488 488 ctx cooccurence:488
Rv0456A mazF1 toxin MazF1 482 482 ctx cooccurence:482
Rv2548 vapC19 ribonuclease VapC19 480 479 ctx cooccurence:476
Rv3408 vapC47 ribonuclease VapC47 465 465 ctx cooccurence:463

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PemK-like protein
  • Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=6e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007411812.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2337
  • Curated reference: UniProt V5QRX7 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor vapC3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3098A|
MVIRGAVYRVDFGDAKRGHEQRGRRYAVVISPGSMPWSVVTVVPTSTSAQPAVFRPELEVMGTKTRFLVDQIRTIGIVYVHGDPVDYLDRDQMAKVEHAVARYLGL