vapC21 Resolved · high auto-curated

H37Rv Rv2757c · MTBC0 mtbc0_002934 · 138 aa · 3092585–3093001 (-) · RefSeq NP_217273.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC21
MTBC0 PGAP re-annotationtype II toxin-antitoxin system toxin ribonuclease C21
Revised (this work)Type II toxin-antitoxin system toxin ribonuclease C21. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF91 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC21
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase (By similarity). Upon expression in M.smegmatis inhibits colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin VapB21.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namevapC
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1487
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045926, GO:0048519, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.976 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 2 nonsense, 0 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.32% of strains (460) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 2.7e-145–122 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB21 (antitoxin VapB21), high confidence from genomic context alone (score 980 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2758c vapB21 antitoxin VapB21 979 980 ctx neighborhood:882 coexpression:804
Rv2756c hsdM type I restriction/modification system DNA methylase HsdM 890 888 ctx neighborhood:598 coexpression:733
Rv2759c vapC42 ribonuclease VapC42 828 764 ctx neighborhood:753
Rv2760c vapB42 antitoxin VapB42 760 760 ctx neighborhood:753
Rv2761c hsdS type I restriction/modification system specificity determinant HsdS 741 741 ctx neighborhood:731
Rv2762c hyp hypothetical protein 960 711 ctx neighborhood:707 textmining:870
Rv2755c hsdS.1 Rv2755c, (MTV002.20c), len: 91 aa. Possible hsdS.1,fragment of type I restriction/modification system specificity determinant (S protein), s 593 594 ctx neighborhood:572
Rv0582 vapC26 ribonuclease VapC26 595 547 ctx cooccurence:538
Rv2763c dfrA dihydrofolate reductase 612 528 ctx neighborhood:523
Rv1607 chaA ionic transporter integral membrane protein ChaA 502 502 ctx cooccurence:499
Rv3407 vapB47 antitoxin VapB47 442 443
Rv0300 vapB2 antitoxin VapB2 433 434 experimental:412
Rv2601A vapB41 antitoxin VapB41 432 410
Rv1952 vapB14 antitoxin VapB14 429 407
Rv2764c thyA thymidylate synthase ThyA 506 403 ctx neighborhood:400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC21
  • MTBC0 PGAP product: type II toxin-antitoxin system toxin ribonuclease C21
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=3e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217273.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1487
  • Curated reference: UniProt P9WF91 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor vapB21
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002934|Rv2757c|vapC21
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEIQEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA