groES Resolved · high auto-curated
H37Rv Rv3418c · MTBC0 - ·
100 aa · 3836986–3837288 (-) ·
RefSeq NP_217935.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | chaperonin GroES |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Chaperonin GroES. Pfam: Cpn10 (PF00166.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WPE5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Co-chaperonin GroES |
| Curated function | Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | groS |
| eggNOG description | Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter |
| Orthologous group | COG0234 |
| KEGG orthology |
K04078
|
| Gene Ontology (63) |
GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006355 +51 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Cpn10 | PF00166.27 | 7.8e-36 | 5–98 | Chaperonin 10 Kd subunit |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: groEL1 (chaperonin GroEL), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3417c groEL1 |
chaperonin GroEL | 999 | 998 ctx | neighborhood:776 cooccurence:772 coexpression:831 experimental:829 textmining:953 |
Rv0440 groEL2 |
molecular chaperone GroEL | 999 | 998 ctx | cooccurence:772 coexpression:960 experimental:829 textmining:938 |
Rv0351 grpE |
stress response protein GrpE | 984 | 913 | coexpression:893 textmining:828 |
Rv0350 dnaK |
chaperone protein DnaK | 988 | 812 | coexpression:743 textmining:939 |
Rv2299c htpG |
chaperone protein HtpG | 954 | 797 | coexpression:769 textmining:785 |
Rv2460c clpP2 |
ATP-dependent CLP protease proteolytic subunit 2 | 870 | 761 ctx | cooccurence:434 experimental:420 textmining:481 |
Rv2264c hyp |
hypothetical protein | 824 | 759 | coexpression:671 |
Rv3446c hyp |
hypothetical protein | 824 | 759 | coexpression:670 |
Rv0312 hyp |
hypothetical protein | 824 | 759 | coexpression:671 |
Rv2461c clpP1 |
ATP-dependent CLP protease proteolytic subunit 1 | 874 | 744 | experimental:420 textmining:530 |
Rv0652 rplL |
50S ribosomal protein L7/L12 | 830 | 702 | coexpression:648 textmining:454 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 695 | 664 | database:604 |
Rv0352 dnaJ1 |
chaperone protein DnaJ | 872 | 644 | coexpression:577 textmining:656 |
Rv3419c gcp |
O-sialoglycoprotein endopeptidase | 758 | 627 ctx | neighborhood:576 |
Rv0070c glyA2 |
serine hydroxymethyltransferase | 640 | 620 | database:546 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): chaperonin GroES
- Pfam (hmmscan --cut_ga): Cpn10 PF00166.27 (E=8e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217935.1)
- Domains: Pfam-A via hmmscan --cut_ga — Cpn10 (PF00166.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0234 - Curated reference: UniProt P9WPE5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
138 functional partner(s); context anchor
groEL1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3418c|groES MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK