ruvX Resolved · high auto-curated

H37Rv Rv2554c · MTBC0 mtbc0_002722 · 170 aa · 2896803–2897315 (-) · RefSeq NP_217070.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)Holliday junction resolvase
MTBC0 PGAP re-annotationHolliday junction resolvase RuvX
Revised (this work)Holliday junction resolvase RuvX. Pfam: RuvX (PF03652.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGV7 SwissProt · reviewed · Evidence at protein level
UniProt namePutative pre-16S rRNA nuclease
EC (curated) EC 3.1.-.-
Curated functionCould be a nuclease involved in processing of the 5'-end of pre-16S rRNA.

UniProt still lists this protein as Putative pre-16S rRNA nuclease; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nameruvX
eggNOG descriptionCould be a nuclease involved in processing of the 5'-end of pre-16S rRNA
Orthologous groupCOG0816
KEGG orthology K07447
Gene Ontology (37) GO:0000966, GO:0000967, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006364, GO:0006396, GO:0006725, GO:0006807 +25 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RuvXPF03652.21 2.0e-3823–155 Holliday junction resolvase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: alaS (alanine--tRNA ligase), high confidence from genomic context alone (score 981 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2555c alaS alanine--tRNA ligase 993 981 ctx neighborhood:881 coexpression:826 textmining:652
Rv2552c aroE shikimate 5-dehydrogenase 909 909 ctx neighborhood:881
Rv2553c mltG membrane protein 908 909 ctx neighborhood:882
Rv2551c hyp hypothetical protein 802 802 ctx neighborhood:793
Rv2556c hyp hypothetical protein 788 789 ctx neighborhood:779
Rv0038 hyp hypothetical protein 741 703 coexpression:678
Rv2537c aroD 3-dehydroquinate dehydratase 581 581 ctx neighborhood:544
Rv2539c aroK shikimate kinase 564 565 ctx neighborhood:544
Rv2540c aroF chorismate synthase 560 560 ctx neighborhood:544
Rv2727c miaA tRNA delta(2)-isopentenylpyrophosphate transferase 545 545 coexpression:508
Rv2557 hyp hypothetical protein 469 469 ctx neighborhood:466
Rv2584c apt adenine phosphoribosyltransferase 442 443 coexpression:426
Rv1644 tsnR 23S rRNA methyltransferase TsnR 438 434
Rv3265c wbbL1 N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase 426 427 coexpression:407
Rv0510 hemC porphobilinogen deaminase 426 426 coexpression:407

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: Holliday junction resolvase
  • MTBC0 PGAP product: Holliday junction resolvase RuvX
  • Pfam (hmmscan --cut_ga): RuvX PF03652.21 (E=2e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217070.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RuvX (PF03652.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0816
  • Curated reference: UniProt P9WGV7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor alaS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002722|Rv2554c|ruvX
MVPAQHRPPDRPGDPAHDPGRGRRLGIDVGAARIGVACSDPDAILATPVETVRRDRSGKHLRRLAALAAELEAVEVIVGLPRTLADRIGRSAQDAIELAEALARRVSPTPVRLADERLTTVSAQRSLRQAGVRASEQRAVIDQAAAVAILQSWLDERLAAMAGTQEGSDA