Rv3242c Family assigned · low auto-curated

H37Rv Rv3242c · MTBC0 mtbc0_003450 · 213 aa · 3643713–3644354 (-) · RefSeq NP_217759.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationComF family protein
Revised (this work)ComF family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05887 TrEMBL · unreviewed · Inferred from homology
UniProt namePhosphoribosyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namepyrE_1
eggNOG descriptionphosphoribosyltransferase
Orthologous groupCOG1040

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.199 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mtrB (two component sensory histidine kinase MtrB), high confidence from genomic context alone (score 712 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2894c xerC tyrosine recombinase XerC 902 902 coexpression:902
Rv1364c sigma factor regulatory protein 892 889 coexpression:874
Rv3754 tyrA prephenate dehydrogenase TyrA 833 821 coexpression:821
Rv2584c apt adenine phosphoribosyltransferase 808 808 coexpression:808
Rv2677c hemY protoporphyrinogen oxidase 787 788 coexpression:776
Rv3332 nagA N-acetylglucosamine-6-phosphate deacetylase NagA 785 786 coexpression:772
Rv3781 rfbE O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE 776 777 coexpression:777
Rv1354c hyp hypothetical protein 746 735 coexpression:649
Rv3243c hyp hypothetical protein 724 725 ctx neighborhood:717
Rv3245c mtrB two component sensory histidine kinase MtrB 711 712 ctx neighborhood:595
Rv3244c lpqB lipoprotein LpqB 681 681 ctx neighborhood:630
Rv2896c dprA hyp hypothetical protein 753 678 coexpression:509
Rv2414c hyp hypothetical protein 689 594 coexpression:428
Rv3246c mtrA two component DNA-binding response regulator MtrA 593 578 ctx neighborhood:556
Rv3296 lhr ATP-dependent helicase 574 575 coexpression:575

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: ComF family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217759.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1040
  • Curated reference: UniProt O05887 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 53 functional partner(s); context anchor mtrB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003450|Rv3242c|
MLDLVLPLECGGCGAPATRWCAACAAELSVAAGEPHVVSPRVDPQVPVFALGRYAGVRRQAILAMKEHGRRDLVAPLACALIVGVDHLLSWGMLENPLTMVPAPTRRWAARRRGGDPVSRMARIAGATLGRHHDVTVVPALRMRALARDSVGLGASARERNITGRVLLRGQRPRNEVVLVDDIITTGATARESVRVLQAAGVRVGAVLAVAAA