nrdH Resolved · high auto-curated

H37Rv Rv3053c · MTBC0 mtbc0_003245 · 79 aa · 3436029–3436268 (-) · RefSeq NP_217569.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutaredoxin electron transport protein NrdH
MTBC0 PGAP re-annotationredoxin NrdH
Revised (this work)Redoxin NrdH. Pfam: Glutaredoxin (PF00462.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YB06 TrEMBL · unreviewed · Evidence at protein level
UniProt nameGlutaredoxin-like protein NrdH
Curated functionElectron transport system for the ribonucleotide reductase system NrdEF.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namenrdH
eggNOG description(Glutaredoxin-like protein) NrdH
Orthologous groupCOG0695
KEGG orthology K06191

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlutaredoxinPF00462.31 6.1e-163–61 Glutaredoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nrdE (ribonucleoside-diphosphate reductase subunit alpha), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 998 997 ctx neighborhood:564 cooccurence:772 coexpression:872 database:614 textmining:696
Rv3052c nrdI NrdI protein 999 995 ctx neighborhood:833 cooccurence:772 coexpression:887 textmining:798
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 878 864 database:614
Rv3048c nrdF2 ribonucleoside-diphosphate reductase subunit beta NrdF2 971 861 ctx cooccurence:773 textmining:801
Rv1981c nrdF1 ribonucleoside-diphosphate reductase subunit beta NrdF1 924 826 ctx cooccurence:772 textmining:585
Rv3050c AsnC family transcriptional regulator 755 756 ctx neighborhood:625
Rv2204c hyp hypothetical protein 757 737 coexpression:728
Rv0038 hyp hypothetical protein 697 662 database:643
Rv0137c msrA peptide methionine sulfoxide reductase MsrA 578 513 experimental:484
Rv1307 atpH ATP synthase subunit b/delta 470 470 coexpression:408
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 455 432
Rv2048c pks12 polyketide synthase 432 251
Rv3303c lpdA NAD(P)H quinone reductase LpdA 407 198
Rv3913 trxB2 thioredoxin reductase 593 196 textmining:515
Rv0233 nrdB ribonucleoside-diphosphate reductase subunit beta NrdB 549 191 textmining:466

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutaredoxin electron transport protein NrdH
  • MTBC0 PGAP product: redoxin NrdH
  • Pfam (hmmscan --cut_ga): Glutaredoxin PF00462.31 (E=6e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217569.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glutaredoxin (PF00462.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0695
  • Curated reference: UniProt I6YB06 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor nrdE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003245|Rv3053c|nrdH
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA