atpC Family assigned · medium auto-curated

H37Rv Rv1311 · MTBC0 mtbc0_001403 · 121 aa · 1476354–1476719 MTBC0 (+) · RefSeq NP_215827.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand prfA (Rv1299) — requalified: peptide chain release factor 1 prfA hemK (Rv1300) — requalified: peptide chain release factor N(5)-glutamine methyltransferas hemK Rv1301 (Rv1301) — requalified: L-threonylcarbamoyladenylate synthase rfe (Rv1302) — requalified: UDP-N-acetylglucosamine--decaprenyl-phosphate N-acetylglucos rfe Rv1303 (Rv1303) — family_assigned: ATP synthase subunit I atpB (Rv1304) — family_assigned: F0F1 ATP synthase subunit A atpE (Rv1305) — family_assigned: F0F1 ATP synthase subunit C atpF (Rv1306) — family_assigned: F0F1 ATP synthase subunit B atpH (Rv1307) — family_assigned: F0F1 ATP synthase subunit B/delta atpH atpA (Rv1308) — family_assigned: F0F1 ATP synthase subunit alpha atpA atpG (Rv1309) — family_assigned: F0F1 ATP synthase subunit gamma atpG atpD (Rv1310) — family_assigned: F0F1 ATP synthase subunit beta atpD atpC (Rv1311) — family_assigned: F0F1 ATP synthase subunit epsilon Rv1312 (Rv1312) — family_assigned: DUF2550 domain-containing protein Rv1314c (Rv1314c) — requalified: cob(I)yrinic acid a%2Cc-diamide adenosyltransferase murA (Rv1315) — requalified: UDP-N-acetylglucosamine 1-carboxyvinyltransferase murA ogt (Rv1316c) — requalified: methylated-DNA--protein-cysteine methyltransferase alkA (Rv1317c) — family_assigned: bifunctional regulatory protein/DNA repair enzyme AlkA alkA Rv1318c (Rv1318c) — family_assigned: adenylate/guanylate cyclase domain-containing protein 1 468 kb 1 472 kb 1 476 kb 1 480 kb 1 484 kb 1 488 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP synthase subunit epsilon
MTBC0 PGAP re-annotationF0F1 ATP synthase subunit epsilon
Revised (this work)F0F1 ATP synthase subunit epsilon. Pfam: ATP-synt_DE_N (PF02823.22).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 7 publications

7 TB publications mention this gene. 7 publication(s) discuss this gene (5 in a M. tuberculosis context).

Most recent 5 of 7.
PublicationDate
Integrating structure-guided and fragment-based inhibitor design to combat bedaquiline resistant Mycobacterium tuberculosis: a molecular dynamics study. doi:10.1080/07391102.2024.2441426 2026
Disrupting coupling within mycobacterial F-ATP synthases subunit ε causes dysregulated energy production and cell wall biosynthesis. doi:10.1038/s41598-019-53107-3 2019
Structure based identification of novel inhibitors against ATP synthase of Mycobacterium tuberculosis: A combined in silico and in vitro study. doi:10.1016/j.ijbiomac.2019.05.108 2019
Examination of bedaquiline- and linezolid-resistant Mycobacterium tuberculosis isolates from the Moscow region. doi:10.1093/jac/dkx094 2017
Resistance related metabolic pathways for drug target identification in Mycobacterium tuberculosis. doi:10.1186/s12859-016-0898-8 2016

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -11.88 (95% CI -13.55 to -10.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionProduces ATP from ADP in the presence of a proton gradient across the membrane [catalytic activity: ATP + H(2)O + H(+)(in) = ADP + phosphate + H(+)(out)]

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1343 · 100.0% identity
M. leprae ML1146 · 87.6% identity
M. marinum MMAR_4086 · 89.3% identity
M. smegmatis MSMEG_4935 · 80.2% identity
M. orygis RJtmp_001381 · 100.0% identity
M. abscessus MAB_1454 · 71.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WPV1 SwissProt · reviewed · Evidence at protein level
UniProt nameATP synthase epsilon chain
Curated functionProduces ATP from ADP in the presence of a proton gradient across the membrane.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameatpC
eggNOG descriptionProduces ATP from ADP in the presence of a proton gradient across the membrane
Orthologous groupCOG0355
KEGG orthology K02114
KEGG pathways map00190, map00195, map01100
KEGG modules M00157
Gene Ontology (95) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005886, GO:0006139, GO:0006163, GO:0006164, GO:0006725, GO:0006753, GO:0006754, GO:0006793 +83 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.11 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 87.2% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 46.8%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callUncertain · uncertain
What the call meansuncertain (short or TA-poor ORF): no call possible
TA sites (Himar1) 2 in the ORF — 1 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.500, mean read count 2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatStatistically thin call: only 2 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance726.0 ppm · rank 304/3519 (91.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length121 aa
Molecular weight13.1 kDa
Theoretical pI4.55
GRAVY-0.061 (hydrophilic)
Aliphatic index103.2
Aromaticity0.041
Instability index39.3 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ATP-synt_DE_NPF02823.22 1.5e-234–84 ATP synthase, Delta/Epsilon chain, beta-sandwich domain

Experimental structures (Protein Data Bank) 5 solved

PDBMethodResolutionCoverage
8j0s Electron Microscopy 2.58 Å 100%
8j0t Electron Microscopy 2.8 Å 100%
8jr0 Electron Microscopy 2.8 Å 100%
5yio Solution NMR 100%
2lx5 Solution NMR 15%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (5 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.4

PDB hitprobTM-scoreE-valueDescription
8j0s-assembly1_H 1.00 0.99 1.3e-21 sig 8j0s-assembly1_H Cryo-EM structure of Mycobacterium tuberculosis ATP synthase in complex with bedaquiline(BDQ)
7xkz-assembly1_A 1.00 0.96 6.1e-18 sig 7xkz-assembly1_A Solution structure of subunit epsilon of the Mycobacterium abscessus F-ATP synthase
5yio-assembly1_A 1.00 0.86 3.2e-18 sig 5yio-assembly1_A NMR solution structure of subunit epsilon of the Mycobacterium tuberculosis F-ATP synthase
7y5c-assembly1_H 1.00 0.93 1.9e-16 sig 7y5c-assembly1_H Cryo-EM structure of F-ATP synthase from Mycolicibacterium smegmatis (rotational state 2)
7nl9-assembly1_H 1.00 0.96 5.1e-14 sig 7nl9-assembly1_H Mycobacterium smegmatis ATP synthase Fo state 3

Foldseek search of the AlphaFold DB model (mean pLDDT 94.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 10

Upstream (5' on genome)atpD (+ strand, 13 bp gap)
Downstream (3' on genome)Rv1312 (+ strand, 7 bp gap)
Predicted operon Rv1303 · atpB · atpE · atpF · atpH · atpA · atpG · atpD · atpC · Rv1312

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: atpF (ATP synthase subunit B), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1306 atpF exp ATP synthase subunit B 999 1000 ctx neighborhood:730 coexpression:943 experimental:870 database:900 textmining:812
Rv1309 atpG exp ATP synthase subunit gamma 999 1000 ctx neighborhood:812 cooccurence:500 coexpression:973 experimental:997 database:965 textmining:838
Rv1308 atpA exp ATP synthase subunit alpha 999 1000 ctx neighborhood:812 coexpression:967 experimental:928 database:984 textmining:804
Rv1310 atpD exp ATP synthase subunit beta 999 1000 ctx neighborhood:867 coexpression:976 experimental:928 database:984 textmining:837
Rv1305 atpE exp ATP synthase subunit C 999 1000 ctx neighborhood:738 cooccurence:436 coexpression:958 experimental:997 database:970 textmining:569
Rv1307 atpH exp ATP synthase subunit b/delta 999 1000 ctx neighborhood:750 coexpression:999 experimental:999 database:980 textmining:819
Rv1304 atpB exp ATP synthase subunit A 999 1000 ctx neighborhood:664 cooccurence:546 coexpression:861 experimental:928 database:967 textmining:823
Rv1507c hyp exp hypothetical protein 985 984 coexpression:730 experimental:829 database:662
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 956 933 coexpression:918
Rv3628 ppa exp inorganic pyrophosphatase 924 925 database:900
Rv1312 hyp hypothetical protein 881 881 ctx neighborhood:881
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 899 859 coexpression:827
Rv3456c rplQ 50S ribosomal protein L17 883 854 coexpression:854
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 883 834 coexpression:834
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 886 827 coexpression:804

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP synthase subunit epsilon
  • MTBC0 PGAP product: F0F1 ATP synthase subunit epsilon
  • Pfam (hmmscan --cut_ga): ATP-synt_DE_N PF02823.22 (E=2e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215827.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ATP-synt_DE_N (PF02823.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0355
  • Curated reference: UniProt P9WPV1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 162 functional partner(s); context anchor atpF
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001403|Rv1311|atpC
MAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVEREGEKDLRIAVDGGFLSVTEEGVSILAESAEFESEIDEAAAKQDSESDDPRIAARGRARLRAVGAID