atpC Family assigned · medium auto-curated

H37Rv Rv1311 · MTBC0 mtbc0_001403 · 121 aa · 1476354–1476719 (+) · RefSeq NP_215827.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP synthase subunit epsilon
MTBC0 PGAP re-annotationF0F1 ATP synthase subunit epsilon
Revised (this work)F0F1 ATP synthase subunit epsilon. Pfam: ATP-synt_DE_N (PF02823.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPV1 SwissProt · reviewed · Evidence at protein level
UniProt nameATP synthase epsilon chain
Curated functionProduces ATP from ADP in the presence of a proton gradient across the membrane.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameatpC
eggNOG descriptionProduces ATP from ADP in the presence of a proton gradient across the membrane
Orthologous groupCOG0355
KEGG orthology K02114
KEGG pathways map00190, map00195, map01100
KEGG modules M00157
Gene Ontology (95) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005886, GO:0006139, GO:0006163, GO:0006164, GO:0006725, GO:0006753, GO:0006754, GO:0006793 +83 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.11 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ATP-synt_DE_NPF02823.22 1.5e-234–84 ATP synthase, Delta/Epsilon chain, beta-sandwich domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: atpF (ATP synthase subunit B), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1306 atpF ATP synthase subunit B 999 1000 ctx neighborhood:730 coexpression:943 experimental:870 database:900 textmining:812
Rv1309 atpG ATP synthase subunit gamma 999 1000 ctx neighborhood:812 cooccurence:500 coexpression:973 experimental:997 database:965 textmining:838
Rv1308 atpA ATP synthase subunit alpha 999 1000 ctx neighborhood:812 coexpression:967 experimental:928 database:984 textmining:804
Rv1310 atpD ATP synthase subunit beta 999 1000 ctx neighborhood:867 coexpression:976 experimental:928 database:984 textmining:837
Rv1305 atpE ATP synthase subunit C 999 1000 ctx neighborhood:738 cooccurence:436 coexpression:958 experimental:997 database:970 textmining:569
Rv1307 atpH ATP synthase subunit b/delta 999 1000 ctx neighborhood:750 coexpression:999 experimental:999 database:980 textmining:819
Rv1304 atpB ATP synthase subunit A 999 1000 ctx neighborhood:664 cooccurence:546 coexpression:861 experimental:928 database:967 textmining:823
Rv1507c hyp hypothetical protein 985 984 coexpression:730 experimental:829 database:662
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 956 933 coexpression:918
Rv3628 ppa inorganic pyrophosphatase 924 925 database:900
Rv1312 hyp hypothetical protein 881 881 ctx neighborhood:881
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 899 859 coexpression:827
Rv3456c rplQ 50S ribosomal protein L17 883 854 coexpression:854
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 883 834 coexpression:834
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 886 827 coexpression:804

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP synthase subunit epsilon
  • MTBC0 PGAP product: F0F1 ATP synthase subunit epsilon
  • Pfam (hmmscan --cut_ga): ATP-synt_DE_N PF02823.22 (E=2e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215827.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ATP-synt_DE_N (PF02823.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0355
  • Curated reference: UniProt P9WPV1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 162 functional partner(s); context anchor atpF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001403|Rv1311|atpC
MAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVEREGEKDLRIAVDGGFLSVTEEGVSILAESAEFESEIDEAAAKQDSESDDPRIAARGRARLRAVGAID