Rv3405c Family assigned · medium auto-curated
H37Rv Rv3405c · MTBC0 mtbc0_003619 ·
188 aa ·
3850141–3850707 MTBC0
(-) ·
RefSeq NP_217922.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | HTH-type transcriptional regulator |
|---|---|
| MTBC0 PGAP re-annotation | helix-turn-helix domain-containing protein |
| Revised (this work) | Helix-turn-helix domain-containing protein. Pfam: TetR_N (PF00440.30). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 7 publications
7 TB publications mention this gene. 7 publication(s) discuss this gene (8 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Impact of Genomic Deletion RD16 on the Expression of the Mycobacterium bovis BCG Moreau VapBC47 Toxin-Antitoxin System. doi:10.3390/cimb45080412 | 2023 |
| Gain of function in Mycobacterium bovis BCG Moreau due to loss of a transcriptional repressor. doi:10.1590/0074-02760180267 | 2018 |
| Biophysical and biochemical characterization of Rv3405c, a tetracycline repressor protein from Mycobacterium tuberculosis. doi:10.1016/j.bbrc.2018.01.152 | 2018 |
| Identification of Antibody Targets for Tuberculosis Serology using High-Density Nucleic Acid Programmable Protein Arrays. doi:10.1074/mcp.M116.065953 | 2017 |
| 2-Carboxyquinoxalines kill mycobacterium tuberculosis through noncovalent inhibition of DprE1. doi:10.1021/cb5007163 | 2015 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.43 (95% CI -1.01 to 2.62). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | May be involved in transcriptional mechanism. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3439c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1142
· 72.7% identity |
| M. smegmatis |
MSMEG_0180
· 57.9% identity |
| M. orygis |
RJtmp_003507
· 100.0% identity |
| M. abscessus |
MAB_0085c
· 48.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WMC3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | HTH-type transcriptional repressor Rv3405c |
| Curated function | Negatively regulates the expression of sulfate ester dioxygenase Rv3406 and its own expression. Binds specifically to the inverted repeat sequence of the intergenic region between Rv3405c and Rv3406. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | transcriptional |
| Orthologous group | COG1309 |
| KEGG orthology |
K22295
|
| Gene Ontology (41) |
GO:0000976, GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737 +29 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 68.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 2/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 43.2% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 2 growth-advantage. Saturation 0.889, mean read count 115. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -3.96 | 0.014 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 13.8 ppm · rank 2531/3519 (28.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 188 aa |
|---|---|
| Molecular weight | 20.6 kDa |
| Theoretical pI | 9.28 |
| GRAVY | -0.141 (hydrophilic) |
| Aliphatic index | 101.9 |
| Aromaticity | 0.048 |
| Instability index | 41.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
TetR_N | PF00440.30 | 1.9e-16 | 23–69 | Bacterial regulatory proteins, tetR family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2fbq-assembly1_A-2 |
1.00 | 0.56 | 4.7e-05 sig | 2fbq-assembly1_A-2 The crystal structure of transcriptional regulator PA3006 |
3bhq-assembly1_B |
1.00 | 0.59 | 3.3e-04 sig | 3bhq-assembly1_B CRYSTAL STRUCTURE OF A PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR (MLR_4833) FROM MESORHIZOBIUM LOTI MAFF303099 AT 1.54 A RESOLUTION |
5d18-assembly1_A |
1.00 | 0.50 | 6.9e-05 sig | 5d18-assembly1_A Crystal structure of Mycobacterium tuberculosis Rv0302, form I |
2jj7-assembly1_A |
1.00 | 0.53 | 3.0e-04 sig | 2jj7-assembly1_A Crystal structure of the HlyIIR mutant protein with residues 170-185 substituted by alanine |
2nx4-assembly2_D |
1.00 | 0.60 | 5.6e-04 sig | 2nx4-assembly2_D The Crystal Structure of athe Putative TetR-family transcriptional regulator Rha06780 from Rhodococcus sp. Rha1. |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3404c (- strand, 117 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3406 (+ strand, 61 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor
| Regulated by (2 TF) |
Rv1353c (represses) · Rv3405c (activates)
|
|---|---|
| Regulon | this transcription factor regulates 6 target gene(s) |
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv3406 (dioxygenase), high confidence from genomic context alone (score 786 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1151c cobB |
NAD-dependent protein deacylase | 806 | 799 | coexpression:799 |
Rv3406 |
dioxygenase | 971 | 786 ctx | neighborhood:786 textmining:870 |
Rv3183 higA3 |
transcriptional regulator | 767 | 767 | coexpression:767 |
Rv2282c |
LysR family HTH-type transcriptional regulator | 764 | 761 | coexpression:731 |
Rv3066 |
DeoR family transcriptional regulator | 740 | 740 | coexpression:740 |
Rv3840 |
transcriptional regulator | 738 | 738 | coexpression:738 |
Rv3488 hyp |
hypothetical protein | 738 | 734 | coexpression:734 |
Rv1960c parD1 |
antitoxin ParD1 | 734 | 734 | coexpression:734 |
Rv0494 |
HTH-type transcriptional regulator | 740 | 733 | coexpression:732 |
Rv0603 hyp |
hypothetical protein | 733 | 733 | coexpression:733 |
Rv3830c |
TetR family transcriptional regulator | 730 | 730 | coexpression:730 |
Rv3736 |
AraC/XylS family transcriptional regulator | 733 | 729 | coexpression:729 |
Rv1027c kdpE |
transcriptional regulator KdpE | 716 | 716 | coexpression:716 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR | 703 | 703 | coexpression:703 |
Rv3291c lrpA |
transcriptional regulator LrpA | 696 | 687 | coexpression:687 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: HTH-type transcriptional regulator
- MTBC0 PGAP product: helix-turn-helix domain-containing protein
- Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=2e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217922.1)
- Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1309 - Curated reference: UniProt P9WMC3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
41 functional partner(s); context anchor
Rv3406 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003619|Rv3405c| MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3405c? Email the maintainer — the message is pre-filled with this gene's details.