PE22 Family assigned · medium auto-curated
H37Rv Rv2107 · MTBC0 - ·
98 aa · 2367359–2367655 (+) ·
RefSeq YP_177858.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE22 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE22. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N6B5
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE family protein PE22 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | PE family |
| Orthologous group | COG0657 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 5.9e-26 | 4–94 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE36 (PPE family protein PPE36), medium confidence from genomic context alone (score 649 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2108 PPE36 |
PPE family protein PPE36 | 760 | 649 ctx | neighborhood:649 |
Rv1801 PPE29 |
PPE family protein PPE29 | 455 | 72 | textmining:437 |
Rv1116 hyp |
hypothetical protein | 870 | 41 | textmining:870 |
Rv0266c oplA |
5-oxoprolinase OplA | 807 | 41 | textmining:807 |
Rv0265c |
iron ABC transporter substrate-binding lipoprotein | 653 | 41 | textmining:653 |
Rv0456A mazF1 |
toxin MazF1 | 577 | 41 | textmining:577 |
Rv3592 mhuD |
heme-degrading monooxygenase | 522 | 41 | textmining:522 |
Rv3533c PPE62 |
PPE family protein PPE62 | 511 | 41 | textmining:511 |
Rv3739c PPE67 |
PPE family protein PPE67 | 458 | 41 | textmining:459 |
Rv3700c egtE |
pyridoxal-phosphate-dependent protein EgtE | 437 | 41 | textmining:437 |
Rv1168c PPE17 |
PPE family protein PPE17 | 431 | 41 | textmining:431 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE22
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=6e-26)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177858.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt L7N6B5 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
11 functional partner(s); context anchor
PPE36 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2107|PE22 MSFVNVDPFGMLAAAATLESLGSHMAVSNAAVASVTTKVPPPAADYVSKKLSLFFSSHGQQYQVQAARGTAFHRKLVRTLANGALAYEEVEIANNEGF