PE22 Family assigned · medium auto-curated

H37Rv Rv2107 · MTBC0 - · 98 aa · 2367359–2367655 (+) · RefSeq YP_177858.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE family protein PE22
MTBC0 PGAP re-annotation
Revised (this work)PE family protein PE22. Pfam: PE (PF00934.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N6B5 TrEMBL · unreviewed · Predicted
UniProt namePE family protein PE22

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionPE family
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 5.9e-264–94 PE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE36 (PPE family protein PPE36), medium confidence from genomic context alone (score 649 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2108 PPE36 PPE family protein PPE36 760 649 ctx neighborhood:649
Rv1801 PPE29 PPE family protein PPE29 455 72 textmining:437
Rv1116 hyp hypothetical protein 870 41 textmining:870
Rv0266c oplA 5-oxoprolinase OplA 807 41 textmining:807
Rv0265c iron ABC transporter substrate-binding lipoprotein 653 41 textmining:653
Rv0456A mazF1 toxin MazF1 577 41 textmining:577
Rv3592 mhuD heme-degrading monooxygenase 522 41 textmining:522
Rv3533c PPE62 PPE family protein PPE62 511 41 textmining:511
Rv3739c PPE67 PPE family protein PPE67 458 41 textmining:459
Rv3700c egtE pyridoxal-phosphate-dependent protein EgtE 437 41 textmining:437
Rv1168c PPE17 PPE family protein PPE17 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE22
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=6e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177858.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt L7N6B5 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor PPE36
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2107|PE22
MSFVNVDPFGMLAAAATLESLGSHMAVSNAAVASVTTKVPPPAADYVSKKLSLFFSSHGQQYQVQAARGTAFHRKLVRTLANGALAYEEVEIANNEGF