mazF1 Resolved · high auto-curated
H37Rv Rv0456A · MTBC0 - ·
93 aa · 547076–547357 (-) ·
RefSeq YP_177621.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | toxin MazF1 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Toxin MazF1. Pfam: PemK_toxin (PF02452.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q6MX40
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable endoribonuclease MazF1 |
| EC (curated) |
EC 3.1.-.-
|
| Curated function | Toxic component of a type II toxin-antitoxin (TA) system, its cognate antitoxin is MazE1 (Probable). Probably an endoribonuclease (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| eggNOG description | Toxic component of a toxin-antitoxin (TA) module |
| Orthologous group | COG2337 |
| KEGG orthology |
K07171
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PemK_toxin | PF02452.24 | 3.4e-11 | 3–57 | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazE9 (antitoxin MazE9), high confidence from genomic context alone (score 992 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2801A mazE9 |
antitoxin MazE9 | 992 | 992 ctx | cooccurence:774 experimental:960 |
Rv2063 mazE7 |
antitoxin MazE7 | 806 | 807 | experimental:793 |
Rv0456B mazE1 |
antitoxin MazE1 | 817 | 781 ctx | neighborhood:781 |
Rv2063A mazF7 |
mRNA interferase MazF7 | 729 | 729 ctx | cooccurence:729 |
Rv1942c mazF5 |
toxin MazF5 | 854 | 669 ctx | cooccurence:668 textmining:577 |
Rv1991A mazE6 |
antitoxin MazE6 | 662 | 616 | experimental:434 |
Rv0457c |
peptidase | 589 | 589 ctx | neighborhood:588 |
Rv0960 vapC9 |
ribonuclease VapC9 | 539 | 523 ctx | cooccurence:519 |
Rv3407 vapB47 |
antitoxin VapB47 | 509 | 510 ctx | cooccurence:508 |
Rv3384c vapC46 |
ribonuclease VapC46 | 513 | 496 ctx | cooccurence:487 |
Rv3098A |
PemK-like protein | 482 | 482 ctx | cooccurence:482 |
Rv1720c vapC12 |
ribonuclease VapC12 | 487 | 468 ctx | cooccurence:462 |
Rv0458 |
aldehyde dehydrogenase | 456 | 455 ctx | neighborhood:426 |
Rv0459 hyp |
hypothetical protein | 426 | 426 ctx | neighborhood:426 |
Rv0065 vapC1 |
ribonuclease VapC1 | 500 | 421 ctx | cooccurence:409 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): toxin MazF1
- Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=3e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177621.1)
- Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2337 - Curated reference: UniProt Q6MX40 (SwissProt, reviewed; Inferred from homology)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
27 functional partner(s); context anchor
mazE9 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0456A|mazF1 MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVVPVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS