mazF1 Resolved · high auto-curated

H37Rv Rv0456A · MTBC0 - · 93 aa · 547076–547357 (-) · RefSeq YP_177621.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)toxin MazF1
MTBC0 PGAP re-annotation
Revised (this work)Toxin MazF1. Pfam: PemK_toxin (PF02452.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q6MX40 SwissProt · reviewed · Inferred from homology
UniProt nameProbable endoribonuclease MazF1
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system, its cognate antitoxin is MazE1 (Probable). Probably an endoribonuclease (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module
Orthologous groupCOG2337
KEGG orthology K07171

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PemK_toxinPF02452.24 3.4e-113–57 PemK-like, MazF-like toxin of type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazE9 (antitoxin MazE9), high confidence from genomic context alone (score 992 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2801A mazE9 antitoxin MazE9 992 992 ctx cooccurence:774 experimental:960
Rv2063 mazE7 antitoxin MazE7 806 807 experimental:793
Rv0456B mazE1 antitoxin MazE1 817 781 ctx neighborhood:781
Rv2063A mazF7 mRNA interferase MazF7 729 729 ctx cooccurence:729
Rv1942c mazF5 toxin MazF5 854 669 ctx cooccurence:668 textmining:577
Rv1991A mazE6 antitoxin MazE6 662 616 experimental:434
Rv0457c peptidase 589 589 ctx neighborhood:588
Rv0960 vapC9 ribonuclease VapC9 539 523 ctx cooccurence:519
Rv3407 vapB47 antitoxin VapB47 509 510 ctx cooccurence:508
Rv3384c vapC46 ribonuclease VapC46 513 496 ctx cooccurence:487
Rv3098A PemK-like protein 482 482 ctx cooccurence:482
Rv1720c vapC12 ribonuclease VapC12 487 468 ctx cooccurence:462
Rv0458 aldehyde dehydrogenase 456 455 ctx neighborhood:426
Rv0459 hyp hypothetical protein 426 426 ctx neighborhood:426
Rv0065 vapC1 ribonuclease VapC1 500 421 ctx cooccurence:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): toxin MazF1
  • Pfam (hmmscan --cut_ga): PemK_toxin PF02452.24 (E=3e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177621.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PemK_toxin (PF02452.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2337
  • Curated reference: UniProt Q6MX40 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor mazE9
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0456A|mazF1
MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVVPVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS