Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator |
| MTBC0 PGAP re-annotation | helix-turn-helix domain-containing protein |
| Revised (this work) | Helix-turn-helix domain-containing protein. Pfam: TetR_N (PF00440.30), TetR_C_43 (PF21597.3). |
Auto-curated: this verdict and function were generated by rules from
PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53612
TrEMBL · unreviewed
· Evidence at protein level
|
| UniProt name | Possible transcriptional regulatory protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
| eggNOG description | Transcriptional regulator |
| Orthologous group | COG1309 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are
computed annotations, not manual curation; cross-check against the primary literature
before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS |
1.065 · relaxed/neutral
|
| Polymorphic sites (≥ 0.1% of strains) |
1 synonymous, 3 missense, 0 nonsense, 0 frameshift
|
pN/pS from segregating SNPs (singletons removed) normalised by possible sites.
Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene).
A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic
variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A
clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a
convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
TetR_N | PF00440.30 |
2.9e-14 | 20–64 |
Bacterial regulatory proteins, tetR family |
TetR_C_43 | PF21597.3 |
4.1e-32 | 85–186 |
Transcriptional regulator SbtR-like, C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
Rv1725c hyp |
hypothetical protein |
829 |
826 |
coexpression:797 |
Rv3055 |
TetR family transcriptional regulator |
808 |
809 |
coexpression:754 |
Rv3183 higA3 |
transcriptional regulator |
798 |
798 |
coexpression:798 |
Rv2488c |
LuxR family transcriptional regulator |
800 |
790 |
coexpression:751 |
Rv0339c iniR |
transcriptional regulator |
790 |
790 |
coexpression:759 |
Rv1931c |
transcriptional regulator |
785 |
785 |
coexpression:732 |
Rv0377 |
HTH-type transcriptional regulator |
859 |
784 |
coexpression:757 |
Rv3164c moxR3 |
methanol dehydrogenase transcriptional regulator MoxR |
772 |
772 |
coexpression:772 |
Rv2506 |
TetR family transcriptional regulator |
761 |
761 |
coexpression:761 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR |
753 |
746 |
coexpression:746 |
Rv0212c nadR |
transcriptional regulator NadR |
750 |
738 |
coexpression:738 |
Rv1359 |
transcriptional regulator |
736 |
736 |
coexpression:687 |
Rv1674c |
transcriptional regulator |
744 |
735 |
coexpression:735 |
Rv3263 |
DNA methylase |
732 |
732 |
coexpression:732 |
Rv0624 vapC30 |
ribonuclease VapC30 |
732 |
732 |
coexpression:732 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression,
experimental, database, text-mining) into a 0–1000 score. The ctx
badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion,
phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an
unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not
depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with
the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional regulator
- MTBC0 PGAP product: helix-turn-helix domain-containing protein
- Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=3e-14), TetR_C_43 PF21597.3 (E=4e-32)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024),
An imputed ancestral reference genome for the MTBC,
doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214581.1)
- Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_43 (PF21597.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1309
- Curated reference: UniProt
O53612
(TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of
145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
45 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000074|Rv0067c|
MAPTDRRVRADAARNRARVLEVAYQTFAADGLSVPVDEIARRAGVGAGTVYRHFPTKEALFQAVIADRMHRIIDKGHALLKSKHPGDALFAFLRSMVLQWGATDRGLVEALAGVGIEISSAAPEAEADFLDLLTDLLRAAQRAGTVRPDVDVLEVKTLLVGCQAMQSYNAELAAKVTDVALDGLRANRK
Spot an error? Suggest an improvement