egtE Resolved · high auto-curated
H37Rv Rv3700c · MTBC0 mtbc0_003922 ·
390 aa · 4166696–4167868 (-) ·
RefSeq NP_218217.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | pyridoxal-phosphate-dependent protein EgtE |
|---|---|
| MTBC0 PGAP re-annotation | ergothioneine biosynthesis PLP-dependent enzyme EgtE |
| Revised (this work) | Ergothioneine biosynthesis PLP-dependent enzyme EgtE. Pfam: Aminotran_5 (PF00266.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O69668
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Hercynylcysteine sulfoxide lyase |
| EC (curated) |
EC 4.4.1.36
|
| Curated function | Catalyzes a C-S bond cleavage, converting hercynylcysteine sulfoxide to 2-sulfenohercynine, a sulfenic acid intermediate that can be spontaneously reduced to ergothioneine. Ergothioneine is a secreted antioxidant that protects mycobacterium from oxidative stress. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | egtE |
| eggNOG description | Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. EgtE subfamily |
| Orthologous group | COG0520 |
| EC number |
EC 4.4.1.36
|
| KEGG orthology |
K18913
|
| KEGG pathways |
map00340
|
| Gene Ontology (59) |
GO:0000096, GO:0000097, GO:0006082, GO:0006520, GO:0006547, GO:0006548, GO:0006575, GO:0006577, GO:0006578, GO:0006725, GO:0006790, GO:0006807 +47 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.189 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 10 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Aminotran_5 | PF00266.26 | 2.2e-30 | 30–375 | Aminotransferase class-V |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: egtC (amidohydrolase EgtC), high confidence from genomic context alone (score 992 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3702c egtC |
amidohydrolase EgtC | 996 | 992 ctx | neighborhood:839 coexpression:441 database:900 textmining:598 |
Rv3701c egtD |
histidine-specific methyltransferase EtgD | 982 | 955 ctx | neighborhood:839 coexpression:734 textmining:623 |
Rv1465 |
nitrogen fixation related protein | 968 | 952 | coexpression:692 experimental:785 |
Rv3704c gshA |
glutamate--cysteine ligase | 954 | 885 ctx | neighborhood:839 textmining:623 |
Rv3703c etgB |
iron(II)-dependent oxidoreductase EgtB | 968 | 882 ctx | neighborhood:839 textmining:745 |
Rv0888 spmT hyp |
hypothetical protein | 783 | 784 | experimental:780 |
Rv1463 sufC |
ABC transporter ATP-binding protein | 957 | 773 | coexpression:693 textmining:822 |
Rv1462 sufD hyp |
hypothetical protein | 953 | 758 | coexpression:648 textmining:815 |
Rv1461 sufB hyp |
hypothetical protein | 761 | 746 | coexpression:648 |
Rv3284 hyp |
hypothetical protein | 700 | 669 | experimental:490 |
Rv0048c |
membrane protein | 578 | 578 ctx | cooccurence:577 |
Rv0517 |
acyltransferase | 572 | 572 ctx | cooccurence:567 |
Rv3779 |
transmembrane protein | 562 | 562 ctx | cooccurence:548 |
Rv3705c hyp |
hypothetical protein | 560 | 560 ctx | neighborhood:553 |
Rv2345 |
transmembrane protein | 464 | 465 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: pyridoxal-phosphate-dependent protein EgtE
- MTBC0 PGAP product: ergothioneine biosynthesis PLP-dependent enzyme EgtE
- Pfam (hmmscan --cut_ga): Aminotran_5 PF00266.26 (E=2e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218217.1)
- Domains: Pfam-A via hmmscan --cut_ga — Aminotran_5 (PF00266.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0520 - Curated reference: UniProt O69668 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
egtC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003922|Rv3700c|egtE MRRSGANSPAGDSLADRWRAARPPVAGLHLDSAACSRQSFAALDAAAQHARHEAEVGGYVAAEAAAAVLDAGRAAVAALSGLPDAEVVFTTGSLHALDLLLGSWPGENRTLACLPGEYGPNLAVMAAHGFDVRPLPTLQDGRVALDDAAFMLADDPPDLVHLTVVASHRGVAQPLAMVAQLCTELKLPLVVDAAQGLGHVDCAVGADVTYASSRKWIAGPRGVGVLAVRPELMERLRARLPAPDWMPPLTVAQQLGFGEANVAARVGFSVALGEHLACGPQAIRARLAELGDIARTVLADVSGWRVVEAVDEPSAITTLAPIDGADPAAVRAWLLSQRRIVTTYAGVERAPLELPAPVLRISPHVDNTADDLDAFAEALVAATAATSGER