crp Family assigned · medium auto-curated

H37Rv Rv3676 · MTBC0 mtbc0_003895 · 224 aa · 4140308–4140982 MTBC0 (+) · RefSeq NP_218193.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cAMP receptor protein
MTBC0 PGAP re-annotationcAMP-activated global transcriptional regulator CRP
Revised (this work)CAMP-activated global transcriptional regulator CRP. Pfam: cNMP_binding (PF00027.36), HTH_Crp_2 (PF13545.13), Crp (PF00325.27).
Functional category (TubercuList)regulatory proteins

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1018 publications

1018 TB publications mention this gene. 1018 publication(s) discuss this gene (948 in a M. tuberculosis context, 35 in other mycobacteria — M. leprae (15), M. smegmatis (13), M. abscessus (4), M. marinum (3)).

Most recent 5 of 1018.
PublicationDate
Diagnostic accuracy of CRP and myeloperoxidase as a 2-marker biosignature for the diagnosis of symptomatic TB. doi:10.1038/s41598-026-58753-y 2026
Comparison of the Efficacy and Prognosis of Different Treatment Strategies for Spinal Tuberculosis Patients Undergoing Vertebral Augmentation Surgery by Mistake. doi:10.1111/os.70373 2026
Multifocal Tuberculous Dactylitis Involving the Hand and Foot in a Pre-adolescent Patient: A Case Report. doi:10.7759/cureus.110156 2026
Community-based tuberculosis screening with computer-aided detection technology alone and in combination with point-of-care C-reactive protein testing: a paired screen-positive trial. doi:10.1016/S1473-3099(26)00222-7 2026
Disseminated Tuberculosis With Presumptive Tricuspid Valve Endocarditis Presenting as Culture-Negative Infective Endocarditis: A Clinical Diagnostic Challenge. doi:10.7759/cureus.109757 2026

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -4.37 (95% CI -7.07 to -0.86). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in transcriptional mechanism.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3700 · 99.6% identity
M. leprae ML2302 · 96.4% identity
M. marinum MMAR_5164 · 96.4% identity
M. smegmatis MSMEG_6189 · 97.3% identity
M. orygis RJtmp_003775 · 99.6% identity
M. abscessus MAB_0416c · 96.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMH3 SwissProt · reviewed · Evidence at protein level
UniProt nameCRP-like cAMP-activated global transcriptional regulator
Curated functionGlobal transcriptional regulator that complexes with cAMP and binds to specific DNA promoter sites, causing DNA-bending, to regulate transcription. cAMP improves binding to specific DNA sequences, probably by altering protein conformation. The CRP regulon is predicted to contain about 115 genes. Some genes are activated by CRP (rpfA, whiB1) while others are repressed (fadD10). There are 2 CRP-binding sites in the promoter of whiB1, at low concentrations of CRP with or without cAMP transcription of whiB1 is enhanced via site CRP1, then repressed as site CRP2 is filled.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameglxR
eggNOG descriptionCOG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases
Orthologous groupCOG0664
KEGG orthology K10914
KEGG pathways map02020, map02024, map02025, map02026, map05111
Gene Ontology (96) GO:0000166, GO:0000976, GO:0001067, GO:0001130, GO:0001216, GO:0001217, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488 +84 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.072 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 · 10 consensus substitution(s)
under purifying selection vs M. canettii (deep divergence; dN/dS=0.0) — a real, constrained gene predating the MTBC clonal expansion
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 96.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 70.1%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callUncertain · uncertain
What the call meansuncertain (short or TA-poor ORF): no call possible
TA sites (Himar1) 3 in the ORF — 0 in the essential state, 0 growth-defect, 3 non-essential, 0 growth-advantage. Saturation 0.667, mean read count 84. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatStatistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance1091.0 ppm · rank 207/3519 (94.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length224 aa
Molecular weight24.8 kDa
Theoretical pI9.57
GRAVY-0.271 (hydrophilic)
Aliphatic index96.7
Aromaticity0.049
Instability index43.4 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
cNMP_bindingPF00027.36 2.7e-2529–114 Cyclic nucleotide-binding domain
HTH_Crp_2PF13545.13 4.9e-18148–221 Crp-like helix-turn-helix domain
CrpPF00325.27 6.4e-05175–204 Bacterial regulatory proteins, crp family

Experimental structures (Protein Data Bank) 6 solved

PDBMethodResolutionCoverage
3d0s X-ray diffraction 2.0 Å 100%
3i54 X-ray diffraction 2.2 Å 100%
3i59 X-ray diffraction 2.29 Å 100%
4a2u X-ray diffraction 2.63 Å 100%
3h3u X-ray diffraction 2.9 Å 100%
3mzh X-ray diffraction 2.9 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (6 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.9

PDB hitprobTM-scoreE-valueDescription
3i54-assembly1_A 1.00 0.96 1.9e-39 sig 3i54-assembly1_A Crystal structure of MtbCRP in complex with cAMP
4cyd-assembly2_C 1.00 0.98 6.6e-38 sig 4cyd-assembly2_C GlxR bound to cAMP
3h3u-assembly1_A 1.00 0.96 2.9e-38 sig 3h3u-assembly1_A Crystal structure of CRP (cAMP receptor Protein) from Mycobacterium tuberculosis
3i59-assembly1_A 1.00 0.97 3.8e-37 sig 3i59-assembly1_A Crystal structure of MtbCRP in complex with N6-cAMP
3i54-assembly2_C 1.00 0.98 9.8e-37 sig 3i54-assembly2_C Crystal structure of MtbCRP in complex with cAMP

Foldseek search of the AlphaFold DB model (mean pLDDT 94.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv3675 (+ strand, 98 bp gap)
Downstream (3' on genome)Rv3677c (- strand, 105 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (1 TF) Rv0081 (activates)
Regulonthis transcription factor regulates 3 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: marP (serine protease), medium confidence from genomic context alone (score 665 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3671c marP serine protease 691 665 ctx neighborhood:655
Rv2239c hyp hypothetical protein 650 650 ctx cooccurence:645
Rv3645 transmembrane protein 725 621
Rv1339 hyp hypothetical protein 655 615 ctx cooccurence:601
Rv2212 adenylyl cyclase 753 610
Rv1625c cya adenylate cyclase 784 594 textmining:491
Rv2435c exp cyclase 772 594 experimental:408 textmining:464
Rv3675 membrane protein 585 585 ctx neighborhood:580
Rv3674c nth endonuclease III 577 577 ctx neighborhood:486
Rv2488c exp LuxR family transcriptional regulator 657 562 experimental:440
Rv1358 exp transcriptional regulator 621 560 experimental:440
Rv0386 exp transcriptional regulator 583 557 experimental:440
Rv1320c adenylate cyclase 746 543 textmining:469
Rv3457c rpoA exp DNA-directed RNA polymerase subunit alpha 524 525 experimental:447
Rv3825c pks2 exp phthioceranic/hydroxyphthioceranic acid synthase 567 520 database:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cAMP receptor protein
  • MTBC0 PGAP product: cAMP-activated global transcriptional regulator CRP
  • Pfam (hmmscan --cut_ga): cNMP_binding PF00027.36 (E=3e-25), HTH_Crp_2 PF13545.13 (E=5e-18), Crp PF00325.27 (E=6e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218193.1)
  • Domains: Pfam-A via hmmscan --cut_ga — cNMP_binding (PF00027.36), HTH_Crp_2 (PF13545.13), Crp (PF00325.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0664
  • Curated reference: UniProt P9WMH3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 103 functional partner(s); context anchor marP
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003895|Rv3676|crp
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR