crp Family assigned · medium auto-curated

H37Rv Rv3676 · MTBC0 mtbc0_003895 · 224 aa · 4140308–4140982 (+) · RefSeq NP_218193.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cAMP receptor protein
MTBC0 PGAP re-annotationcAMP-activated global transcriptional regulator CRP
Revised (this work)CAMP-activated global transcriptional regulator CRP. Pfam: cNMP_binding (PF00027.36), HTH_Crp_2 (PF13545.13), Crp (PF00325.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMH3 SwissProt · reviewed · Evidence at protein level
UniProt nameCRP-like cAMP-activated global transcriptional regulator
Curated functionGlobal transcriptional regulator that complexes with cAMP and binds to specific DNA promoter sites, causing DNA-bending, to regulate transcription. cAMP improves binding to specific DNA sequences, probably by altering protein conformation. The CRP regulon is predicted to contain about 115 genes. Some genes are activated by CRP (rpfA, whiB1) while others are repressed (fadD10). There are 2 CRP-binding sites in the promoter of whiB1, at low concentrations of CRP with or without cAMP transcription of whiB1 is enhanced via site CRP1, then repressed as site CRP2 is filled.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameglxR
eggNOG descriptionCOG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases
Orthologous groupCOG0664
KEGG orthology K10914
KEGG pathways map02020, map02024, map02025, map02026, map05111
Gene Ontology (96) GO:0000166, GO:0000976, GO:0001067, GO:0001130, GO:0001216, GO:0001217, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488 +84 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.072 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
cNMP_bindingPF00027.36 2.7e-2529–114 Cyclic nucleotide-binding domain
HTH_Crp_2PF13545.13 4.9e-18148–221 Crp-like helix-turn-helix domain
CrpPF00325.27 6.4e-05175–204 Bacterial regulatory proteins, crp family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: marP (serine protease), medium confidence from genomic context alone (score 665 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3671c marP serine protease 691 665 ctx neighborhood:655
Rv2239c hyp hypothetical protein 650 650 ctx cooccurence:645
Rv3645 transmembrane protein 725 621
Rv1339 hyp hypothetical protein 655 615 ctx cooccurence:601
Rv2212 adenylyl cyclase 753 610
Rv1625c cya adenylate cyclase 784 594 textmining:491
Rv2435c cyclase 772 594 experimental:408 textmining:464
Rv3675 membrane protein 585 585 ctx neighborhood:580
Rv3674c nth endonuclease III 577 577 ctx neighborhood:486
Rv2488c LuxR family transcriptional regulator 657 562 experimental:440
Rv1358 transcriptional regulator 621 560 experimental:440
Rv0386 transcriptional regulator 583 557 experimental:440
Rv1320c adenylate cyclase 746 543 textmining:469
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 524 525 experimental:447
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 567 520 database:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cAMP receptor protein
  • MTBC0 PGAP product: cAMP-activated global transcriptional regulator CRP
  • Pfam (hmmscan --cut_ga): cNMP_binding PF00027.36 (E=3e-25), HTH_Crp_2 PF13545.13 (E=5e-18), Crp PF00325.27 (E=6e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218193.1)
  • Domains: Pfam-A via hmmscan --cut_ga — cNMP_binding (PF00027.36), HTH_Crp_2 (PF13545.13), Crp (PF00325.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0664
  • Curated reference: UniProt P9WMH3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 103 functional partner(s); context anchor marP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003895|Rv3676|crp
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR