Rv2104a Family assigned · medium
H37Rv Rv2104a · MTBC0 - ·
85 aa ·
2364797–2365054 H37Rv
(-) ·
RefSeq YP_009030035.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Proteasome-alpha-subunit-family protein, located in the M. tuberculosis proteasome gene region. HHpred: 25/25 top hits are 20S-proteasome alpha-type subunits (incl. the M.tb proteasome alpha 3MI0, 88.4%); eggNOG COG0638 (20S proteasome alpha/beta) with EC 3.4.25.1. Genomic context: immediately flanked by the proteasome core/Pup genes prcA (Rv2109c), prcB (Rv2110c) and pafA (Rv2097c); under purifying selection. At 85 aa it is a small/partial proteasome-alpha-fold protein - whether a bona fide additional subunit or a proteasome-associated protein is undetermined (the canonical alpha subunit is prcA/Rv2109c). |
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 46% of residues (metapredict) |
|---|---|
| Disordered regions | 1 IDR(s), longest 39 aa [46-85] |
carries a substantial disordered region (39/85 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Central Carbon Metabolism.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | prcA |
| eggNOG description | Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation |
| Orthologous group | COG0638 |
| EC number |
EC 3.4.25.1
|
| KEGG orthology |
K03432
|
| KEGG pathways |
map03050
|
| KEGG modules |
M00342, M00343
|
| Gene Ontology (55) |
GO:0000502, GO:0003674, GO:0003824, GO:0004175, GO:0004298, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005839, GO:0005886, GO:0006508 +43 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.261 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (301) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) MTBC-specific
| M. canettii dN/dS (deep-divergence selection) |
0.099 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 0/53 (0%)
· 0/4 closest MTBAP relatives absent from ALL 53 non-MTBC Mycobacterium genomes tested (incl. the closest MTBAP relatives) — a candidate MTBC-specific genetic innovation / host-adaptation factor (confirm by synteny; rule out a short/low-complexity ORF and extreme divergence) |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria short ORF (85 aa) a shallow stratum may reflect homology-detection failure, not true youth absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Physico-chemical properties (computed, ProtParam)
| Length | 85 aa |
|---|---|
| Molecular weight | 9.4 kDa |
| Theoretical pI | 11.71 |
| GRAVY | -0.579 (hydrophilic) |
| Aliphatic index | 80.5 |
| Aromaticity | 0.024 |
| Instability index | 65.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | vapB37 (- strand, 15 bp gap) |
|---|---|
| Downstream (3' on genome) | PE22 (+ strand, 2304 bp gap) |
| Predicted operon |
vapC37 · vapB37 · Rv2104a
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Evidence
- HHpred: 25/25 hits are 20S-proteasome alpha-type subunits (3MI0 M.tb proteasome alpha 88.43% E1.3; 1Q5Q, 1RYP, 5LE5, 9O3F...) = overwhelming family-specific convergence (modest per-hit E but one specific family).
- eggNOG COG0638 (20S proteasome, alpha and beta subunits) + EC 3.4.25.1 (proteasome endopeptidase).
- Cross-check (upgrades the modest HHpred): genomic neighbours = M.tb proteasome region (Rv2109c prcA, Rv2110c prcB, Rv2097c pafA); purifying selection -> conserved, NOT a degenerate fragment. This reverses the size-based skip in phase18 (85 aa was treated as a fragment).
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_009030035.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0638 - Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 54.1, low)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2104a| MTFTTVVLNPPLATLEVAVLDADRLRRAFRRIAGAALGKRLRELDRKDAKGHKGVPRAPKTPSPTANRRISDGPARRLTRCCRQS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2104a? Email the maintainer — the message is pre-filled with this gene's details.