pup Family assigned · medium auto-curated

H37Rv Rv2111c · MTBC0 - · 64 aa · 2370598–2370792 (-) · RefSeq NP_216627.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ubiquitin-like protein Pup
MTBC0 PGAP re-annotation
Revised (this work)Ubiquitin-like protein Pup. Pfam: Pup (PF05639.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WHN5 SwissProt · reviewed · Evidence at protein level
UniProt nameProkaryotic ubiquitin-like protein Pup
Curated functionProtein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation. Among the identified substrates are the FabD, PanB and Mpa proteins.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred namepup
eggNOG descriptionProtein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation
Orthologous group2E9C2
KEGG orthology K13570
Gene Ontology (39) GO:0003674, GO:0005488, GO:0006464, GO:0006508, GO:0006807, GO:0008150, GO:0008152, GO:0009056, GO:0009057, GO:0009987, GO:0010498, GO:0018193 +27 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PupPF05639.17 3.5e-225–64 Pup-like protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: prcB (proteasome subunit beta), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2110c prcB proteasome subunit beta 999 997 ctx neighborhood:882 cooccurence:749 experimental:898 textmining:735
Rv2109c prcA proteasome subunit alpha 998 997 ctx neighborhood:881 cooccurence:750 experimental:898 textmining:684
Rv2115c mpa proteasome-associated ATPase 997 996 ctx cooccurence:764 experimental:982
Rv2112c dop pup deamidase/depupylase 967 948 ctx neighborhood:766 cooccurence:768 textmining:411
Rv2097c pafA proteasome accessory factor PafA 926 905 ctx neighborhood:504 cooccurence:769
Rv3780 bpa hyp hypothetical protein 694 681 ctx cooccurence:679
Rv1457c antibiotic ABC transporter permease 463 463 ctx cooccurence:463
Rv0819 mshD mycothiol acetyltransferase 460 461 ctx cooccurence:458
Rv2466c hyp hypothetical protein 435 436 ctx cooccurence:434
Rv1082 mca mycothiol S-conjugate amidase 433 433 ctx cooccurence:425
Rv2286c hyp hypothetical protein 425 426 ctx cooccurence:424
Rv1331 clpS ATP-dependent Clp protease adapter protein ClpS 420 421
Rv3221A rshA anti-sigma factor RshA 413 414 ctx cooccurence:412
Rv2113 integral membrane protein 405 406 ctx neighborhood:406
Rv3118 sseC1 hyp hypothetical protein 630 222 textmining:544

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): ubiquitin-like protein Pup
  • Pfam (hmmscan --cut_ga): Pup PF05639.17 (E=4e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216627.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pup (PF05639.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E9C2
  • Curated reference: UniProt P9WHN5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor prcB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2111c|pup
MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ