mhuD Resolved · high auto-curated

H37Rv Rv3592 · MTBC0 mtbc0_003811 · 105 aa · 4057734–4058051 (+) · RefSeq NP_218109.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)heme-degrading monooxygenase
MTBC0 PGAP re-annotationmycobilin-forming heme oxygenase MhuD
Revised (this work)Mycobilin-forming heme oxygenase MhuD. Pfam: ABM (PF03992.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKH3 SwissProt · reviewed · Evidence at protein level
UniProt nameHeme oxygenase
EC (curated) EC 1.14.99.57
Curated functionCatalyzes the oxidative degradation of the heme macrocyclic porphyrin ring in the presence of a suitable electron donor such as ascorbate or NADPH--cytochrome P450 reductase, with subsequent release of free iron.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namemhuD
eggNOG descriptionAntibiotic biosynthesis monooxygenase
Orthologous groupCOG2329
EC number EC 1.14.99.57
KEGG orthology K21481
Gene Ontology (49) GO:0003674, GO:0003824, GO:0004392, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006725, GO:0006778, GO:0006787, GO:0006807 +37 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABMPF03992.23 4.8e-202–75 Antibiotic biosynthesis monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpqF (lipoprotein LpqF), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3593 lpqF lipoprotein LpqF 984 884 ctx neighborhood:881 textmining:870
Rv3591c hydrolase 791 791 ctx neighborhood:791
Rv0087 hycE formate hydrogenase HycE 530 530 ctx neighborhood:530
Rv3594 hyp hypothetical protein 493 493 ctx neighborhood:493
Rv0959 hyp hypothetical protein 415 416 ctx cooccurence:414
Rv3590c PE_PGRS58 PE-PGRS family protein PE_PGRS58 413 413 ctx neighborhood:413
Rv0206c mmpL3 transmembrane transport protein MmpL3 626 200 textmining:552
Rv0265c iron ABC transporter substrate-binding lipoprotein 708 190 textmining:655
Rv2388c hemN oxygen-independent coproporphyrinogen III oxidase 663 112 textmining:637
Rv0202c mmpL11 transmembrane transport protein MmpL11 683 78 textmining:670
Rv2711 ideR iron-dependent repressor and activator IdeR 479 73 textmining:461
Rv1348 irtA iron ABC transporter ATP-binding protein/permease IrtA 462 73 textmining:444
Rv0451c mmpS4 membrane protein MmpS4 516 51 textmining:511
Rv3533c PPE62 PPE family protein PPE62 543 47 textmining:541
Rv0203 hyp hypothetical protein 870 45 textmining:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: heme-degrading monooxygenase
  • MTBC0 PGAP product: mycobilin-forming heme oxygenase MhuD
  • Pfam (hmmscan --cut_ga): ABM PF03992.23 (E=5e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218109.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABM (PF03992.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2329
  • Curated reference: UniProt P9WKH3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor lpqF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003811|Rv3592|mhuD
MPVVKINAIEVPAGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVKGEERYFVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLDVGGTGKTA