PPE67 Family assigned · medium auto-curated
H37Rv Rv3739c · MTBC0 - ·
77 aa · 4190284–4190517 (-) ·
RefSeq YP_178010.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PPE family protein PPE67 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PPE family protein PPE67. Pfam: PPE (PF00823.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FA2
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | PPE family protein PPE67 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motility
|
|---|---|
| eggNOG description | PPE family |
| Orthologous group | COG5651 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.863 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 7 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.25% of strains (361) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PPE | PF00823.26 | 2.3e-25 | 6–77 | PPE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE66 (PPE family protein PPE66), high confidence from genomic context alone (score 787 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3738c PPE66 |
PPE family protein PPE66 | 891 | 787 ctx | neighborhood:627 textmining:510 |
Rv3740c |
diacyglycerol O-acyltransferase | 409 | 410 ctx | neighborhood:404 |
Rv3741c |
oxidoreductase | 408 | 408 ctx | neighborhood:404 |
Rv3742c |
oxidoreductase | 407 | 407 ctx | neighborhood:404 |
Rv2431c PE25 |
PE family protein PE25 | 478 | 155 | textmining:408 |
Rv3022A PE29 |
PE family protein PE29 | 560 | 71 | textmining:546 |
Rv3736 |
AraC/XylS family transcriptional regulator | 522 | 64 | textmining:511 |
Rv3517 hyp |
hypothetical protein | 633 | 60 | textmining:626 |
Rv3737 |
transmembrane protein | 657 | 47 | textmining:655 |
Rv3746c PE34 |
PE family protein PE34 | 564 | 41 | textmining:564 |
Rv2328 PE23 |
PE family protein PE23 | 543 | 41 | textmining:543 |
Rv0872c PE_PGRS15 |
PE-PGRS family protein PE_PGRS15 | 543 | 41 | textmining:543 |
Rv2634c PE_PGRS46 |
PE-PGRS family protein PE_PGRS46 | 543 | 41 | textmining:543 |
Rv1519 hyp |
hypothetical protein | 516 | 41 | textmining:516 |
Rv2107 PE22 |
PE family protein PE22 | 458 | 41 | textmining:459 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE67
- Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=2e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178010.1)
- Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5651 - Curated reference: UniProt Q79FA2 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
17 functional partner(s); context anchor
PPE66 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3739c|PPE67 MTAPIWFASPPEVHSALLSAGPGPASLQAAAAEWTSLSAEYASAAQELTAVLAAVQGGAWEGPSAEAYVAAHLPYLA