Rv2044c Family assigned · low

H37Rv Rv2044c · MTBC0 - · 105 aa · 2289282–2289599 (-) · RefSeq NP_216560.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Polytopic integral membrane protein with 3 predicted transmembrane helices (DeepTMHMM). RefSeq leaves it 'hypothetical protein'. A topological feature consistent with a membrane transporter/permease or membrane-embedded enzyme; the transported substrate and molecular function are undetermined.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53487 TrEMBL · unreviewed · Predicted
UniProt nameDUF2784 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of Unknown function (DUF2784)
Orthologous group2CNK3

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 6.00% of strains (8707) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2784PF10861.14 2.4e-311–99 Protein of Unknown function (DUF2784)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lipT (carboxylesterase LipT), high confidence from genomic context alone (score 785 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2045c lipT carboxylesterase LipT 785 785 ctx neighborhood:782
Rv2042c hyp hypothetical protein 958 692 ctx neighborhood:690 textmining:870
Rv2043c pncA pyrazinamidase/nicotinamidase PncA 888 691 ctx neighborhood:690 textmining:652
Rv2041c sugar ABC transporter substrate-binding lipoprotein 578 577 ctx neighborhood:571
Rv2039c sugar ABC transporter permease 576 576 ctx neighborhood:558
Rv2038c ugpC sugar ABC transporter ATP-binding protein 569 569 ctx neighborhood:558
Rv2040c sugar ABC transporter permease 569 568 ctx neighborhood:558
Rv2037c transmembrane protein 555 555 ctx neighborhood:550
Rv3397c phyA phytoene synthase 544 545 ctx neighborhood:544
Rv3091 hyp hypothetical protein 511 511 ctx cooccurence:511
Rv2046 lppI lipoprotein LppI 483 482 ctx neighborhood:480
Rv2695 hyp hypothetical protein 410 411 ctx cooccurence:407
Rv2307c hyp hypothetical protein 409 410
Rv2783c gpsI bifunctional guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase 512 41 textmining:512

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • DeepTMHMM: 3 transmembrane helices (type TM)
  • Integral membrane topology (localisation feature, not a function)
  • DeepTMHMM topology prediction (project 'Still unknown gene function', phase8, 2026-06-10). A topological feature, not a demonstrated molecular function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216560.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2784 (PF10861.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CNK3
  • Curated reference: UniProt O53487 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 82.4, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor lipT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2044c|
MHFAFIAYVLAGGFLALRWRRTMWLHVPAVIWGIGIAAKRVDCPLTWVERWARTKAAMTPLSPDGFVAHYITGVIYPAGWVAAAQLVMFAIVAASWTLYLWLPRR