Rv0837c Family assigned · medium auto-curated

H37Rv Rv0837c · MTBC0 mtbc0_000892 · 342 aa · 936154–937182 (-) · RefSeq NP_215352.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationtype IV toxin-antitoxin system AbiEi family antitoxin
Revised (this work)Type IV toxin-antitoxin system AbiEi family antitoxin. Pfam: AbiEi_2 (PF09952.15).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y4Y1 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionTranscriptional regulator, AbiEi antitoxin, Type IV TA system
Orthologous groupCOG4861

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.273 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 2.59% of strains (3762) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AbiEi_2PF09952.15 2.6e-44200–334 Transcriptional regulator, AbiEi antitoxin, Type IV TA system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE8 (PPE family protein PPE8), high confidence from genomic context alone (score 753 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0836c hyp hypothetical protein 997 989 ctx neighborhood:754 cooccurence:774 coexpression:815 textmining:758
Rv0355c PPE8 PPE family protein PPE8 753 753 ctx cooccurence:753
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 752 752 ctx cooccurence:752
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 752 752 ctx cooccurence:752
Rv3347c PPE55 PPE family protein PPE55 752 752 ctx cooccurence:752
Rv1004c membrane protein 751 752 ctx cooccurence:751
Rv3350c PPE56 PPE family protein PPE56 751 752 ctx cooccurence:751
Rv2209 integral membrane protein 751 752 ctx cooccurence:751
Rv0304c PPE5 PPE family protein PPE5 746 746 ctx cooccurence:746
Rv1917c PPE34 PPE family protein PPE34 743 744 ctx cooccurence:743
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 742 742 ctx cooccurence:742
Rv3343c PPE54 PPE family protein PPE54 740 740 ctx cooccurence:740
Rv2082 hyp hypothetical protein 737 737 ctx cooccurence:736
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 728 728 ctx cooccurence:728
Rv2819c csm5 CRISPR type III-associated RAMP protein Csm5 722 722 ctx cooccurence:722

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: type IV toxin-antitoxin system AbiEi family antitoxin
  • Pfam (hmmscan --cut_ga): AbiEi_2 PF09952.15 (E=3e-44)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215352.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AbiEi_2 (PF09952.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4861
  • Curated reference: UniProt I6Y4Y1 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 102 functional partner(s); context anchor PPE8
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000892|Rv0837c|
MDQIGADLAEAVERHLTEYGVRVLGGLSALNSAHPESLDLEIDAHPLTITALYLPHLSATAALQAWDTAGAGSPLLVVGPRLHPSSAETLRARGLWYIDGAGNAYLRHQGGLLIDVRGRRSAVSAQPGTLGDGLHSDGPRNPFTPKRAQVVCVLLDAPQLVDAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRRLVRTDELLDLWAAAYPGGLGRANKLLVASGDIHTWSAPDGLAVAVSGEQALPDEIRNPESLMLYVDTPAPGLPADLLIHNRWHRDPHGSIVIRKLFWRNLPDEQPGLAPTALIYADLLASREPRQVEVAHLMRRQDERLARL