Rv3351c Family assigned · medium auto-curated
H37Rv Rv3351c · MTBC0 - ·
264 aa · 3767346–3768140 (-) ·
RefSeq NP_217868.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains BBE (PF08031.18) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O50380
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Berberine/berberine-like domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | oxidoreductase |
| Orthologous group | COG0277 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 4 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (302) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BBE | PF08031.18 | 4.2e-07 | 150–182 | Berberine and berberine like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3352c (oxidoreductase), high confidence from genomic context alone (score 883 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3352c |
oxidoreductase | 883 | 883 ctx | neighborhood:605 fusion:556 |
Rv1551 plsB1 |
acyltransferase PlsB | 678 | 664 | database:549 |
Rv3633 hyp |
hypothetical protein | 630 | 617 | database:463 |
Rv2482c plsB2 |
glycerol-3-phosphate acyltransferase | 619 | 602 | database:549 |
Rv0210 hyp |
hypothetical protein | 601 | 601 ctx | cooccurence:601 |
Rv0941c hyp |
hypothetical protein | 595 | 595 ctx | cooccurence:594 |
Rv1501 hyp |
hypothetical protein | 601 | 587 | database:463 |
Rv3806c ubiA |
decaprenyl-phosphate phosphoribosyltransferase | 590 | 570 | database:552 |
Rv0538 |
membrane protein | 568 | 568 ctx | cooccurence:567 |
Rv3687c rsfB |
anti-anti-sigma factor RsfB | 564 | 565 ctx | cooccurence:562 |
Rv1310 atpD |
ATP synthase subunit beta | 572 | 556 | database:538 |
Rv3882c eccE1 |
ESX-1 secretion system protein EccE1 | 544 | 544 ctx | cooccurence:544 |
Rv1305 atpE |
ATP synthase subunit C | 538 | 538 | database:526 |
Rv2035 hyp |
hypothetical protein | 537 | 538 ctx | cooccurence:533 |
Rv2721c hyp |
hypothetical protein | 531 | 531 ctx | cooccurence:530 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): BBE PF08031.18 (E=4e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217868.1)
- Domains: Pfam-A via hmmscan --cut_ga — BBE (PF08031.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0277 - Curated reference: UniProt O50380 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
63 functional partner(s); context anchor
Rv3352c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3351c| MLASCPARSGAAVADAIKSAVGVQPSGVEHKTLRRMDLVRYLAGGHTTYPPEGFVAGSDVIGTTNPAAAQAIVAAIGTWPPAAGRASALIDSLGGAVGDMDPEGSAFPWCRQSAVVQWYVNTPSDGQVATANKWLSDAHHAVQHFSVGGYVNYLEANAAASQYFGANLSRLTTVRRKYDPDRIMYSGLDFSTRQVAERLLPALGFRVRFGVLVIRCALCTDTVKRLGTLPNLTWSRLKVNVAVTQEQAGVMDLPALPVRRTPRR