Rv2021c Family assigned · medium auto-curated

H37Rv Rv2021c · MTBC0 mtbc0_002151 · 101 aa · 2290418–2290723 (-) · RefSeq NP_216537.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationXRE family transcriptional regulator
Revised (this work)XRE family transcriptional regulator. Pfam: HTH_37 (PF13744.13), HTH_31 (PF13560.13), HTH_3 (PF01381.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53467 SwissProt · reviewed · Evidence at protein level
UniProt namePutative antitoxin HigA2
Curated functionPutative antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin would be HigB2.

UniProt still lists this protein as Putative antitoxin HigA2; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionHelix-turn-helix domain
Orthologous groupCOG1396
Gene Ontology (27) GO:0002791, GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0008150, GO:0010565, GO:0019216, GO:0019217, GO:0019222, GO:0031323, GO:0032879 +15 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_37PF13744.13 4.1e-1033–92 Helix-turn-helix domain
HTH_31PF13560.13 7.6e-0933–84 Helix-turn-helix domain
HTH_3PF01381.29 1.4e-1035–88 Helix-turn-helix

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2020c (Rv2020c, (MTV018.07c), len: 99 aa. Conserved hypothetical protein, nearly identical to C-terminal part of hypothetical protein RvD1-Rv2024c'), medium confidence from genomic context alone (score 555 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2022c higB2 hyp hypothetical protein 998 981 ctx neighborhood:786 fusion:648 cooccurence:771 textmining:912
Rv3182 higB3 hyp hypothetical protein 954 781 ctx cooccurence:768 textmining:800
Rv2023c hyp hypothetical protein 703 703 ctx neighborhood:701
Rv0744c transcriptional regulator 580 580 coexpression:580
Rv2020c Rv2020c, (MTV018.07c), len: 99 aa. Conserved hypothetical protein, nearly identical to C-terminal part of hypothetical protein RvD1-Rv2024c' 555 555 ctx neighborhood:552
Rv0332 hyp hypothetical protein 520 494 experimental:434
Rv0623 vapB30 antitoxin VapB30 651 469 ctx cooccurence:445
Rv0366c hyp hypothetical protein 473 445 experimental:434
Rv2807 hyp hypothetical protein 430 431 ctx cooccurence:428
Rv3183 higA3 transcriptional regulator 432 317
Rv2515c hyp hypothetical protein 400 312
Rv1740 vapB34 antitoxin VapB34 495 286
Rv2017 transcriptional regulator 492 282
Rv1956 higA antitoxin HigA 839 219 textmining:803
Rv1246c relE toxin RelE 474 219

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: XRE family transcriptional regulator
  • Pfam (hmmscan --cut_ga): HTH_37 PF13744.13 (E=4e-10), HTH_31 PF13560.13 (E=8e-09), HTH_3 PF01381.29 (E=1e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216537.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_37 (PF13744.13), HTH_31 (PF13560.13), HTH_3 (PF01381.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1396
  • Curated reference: UniProt O53467 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv2020c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002151|Rv2021c|
MAMTLRDMDAVRPVNREAVDRHKARMRDEVRAFRLRELRAAQSLTQVQVAALAHIRQSRVSSIENGDIGSAQVNTLRKYVSALGGELDITVRLGDETFTLA