relF Resolved · high auto-curated

H37Rv Rv2865 · MTBC0 mtbc0_003047 · 93 aa · 3198203–3198484 (+) · RefSeq NP_217381.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin RelF
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin RelF
Revised (this work)Type II toxin-antitoxin system antitoxin RelF. Pfam: PhdYeFM_antitox (PF02604.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33347 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin RelF
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of toxin RelE2.; FUNCTION: Induces its own promoter, in combination with RelG represses its own promoter. Has been seen to bind DNA in complex with toxin RelG but not alone.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namerelF
eggNOG descriptionAntitoxin component of a toxin-antitoxin (TA) module
Orthologous groupCOG2161
Gene Ontology (26) GO:0003674, GO:0005488, GO:0005515, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0019219, GO:0019222, GO:0031323, GO:0031326 +14 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.978 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PhdYeFM_antitoxPF02604.27 2.0e-211–72 Antitoxin Phd_YefM, type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: relG (toxin RelG), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2866 relG toxin RelG 998 994 ctx neighborhood:788 cooccurence:773 experimental:893 textmining:820
Rv1246c relE toxin RelE 975 872 ctx cooccurence:774 textmining:815
Rv3358 relK toxin RelK 923 763 experimental:748 textmining:690
Rv0659c mazF2 toxin MazF2 674 634 ctx cooccurence:627
Rv1942c mazF5 toxin MazF5 648 610 ctx cooccurence:604
Rv2864c penicillin-binding lipoprotein 468 469 ctx neighborhood:464
Rv0960 vapC9 ribonuclease VapC9 521 427 ctx cooccurence:409
Rv2017 transcriptional regulator 413 411
Rv1720c vapC12 ribonuclease VapC12 405 385
Rv1102c mazF3 mRNA interferase MazF3 500 370
Rv0595c vapC4 ribonuclease VapC4 469 367
Rv1495 mazF4 mRNA interferase MazF4 421 274
Rv0549c vapC3 ribonuclease VapC3 553 217 textmining:454
Rv2021c higA2 transcriptional regulator 428 187
Rv2022c higB2 hyp hypothetical protein 510 167 textmining:436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin RelF
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin RelF
  • Pfam (hmmscan --cut_ga): PhdYeFM_antitox PF02604.27 (E=2e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217381.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PhdYeFM_antitox (PF02604.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2161
  • Curated reference: UniProt O33347 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor relG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003047|Rv2865|relF
MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGEDEIRAEFGVPRRPH