mce3F Family assigned · medium auto-curated
H37Rv Rv1971 · MTBC0 mtbc0_002087 ·
437 aa ·
2234374–2235687 MTBC0
(+) ·
RefSeq NP_216487.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | Mce family protein Mce3F |
|---|---|
| MTBC0 PGAP re-annotation | MlaD family protein |
| Revised (this work) | MlaD family protein. Pfam: MlaD (PF02470.26). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 5 publications
5 TB publications mention this gene. 5 publication(s) discuss this gene (5 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Evaluation of immunodominant peptides of in vivo expressed mycobacterial antigens in an ELISA-based diagnostic assay for pulmonary tuberculosis. doi:10.1007/s42770-023-00998-0 | 2023 |
| Transcriptional Profile of Mycobacterium tuberculosis in an in vitro Model of Intraocular Tuberculosis. doi:10.3389/fcimb.2018.00330 | 2018 |
| A Nonsynonymous SNP Catalog of Mycobacterium tuberculosis Virulence Genes and Its Use for Detecting New Potentially Virulent Sublineages. doi:10.1093/gbe/evx053 | 2017 |
| Mycobacterium tuberculosis Rv0198c, a putative matrix metalloprotease is involved in pathogenicity. doi:10.1016/j.tube.2010.11.010 | 2011 |
| Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. doi:10.1111/j.0300-9475.2004.01490.x | 2004 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Mce3R (mce3R).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.31 (95% CI -1.43 to 4.99). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Unknown, but thought involved in host cell invasion. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. marinum |
MMAR_2887
· 80.5% identity |
|---|---|
| M. smegmatis |
MSMEG_0351
· 64.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53972
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Mce-family protein Mce3F |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | mce3F |
| eggNOG description | Virulence factor Mce family protein |
| Orthologous group | COG1463 |
| KEGG orthology |
K02067
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00210, M00669, M00670
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.72 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 8 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 5.19% of strains (7539) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 66.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 38.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Regions of Difference (lineage deletions)
| RD | Gene overlap | Deleted in lineages |
|---|---|---|
RD7 |
100% | L6, L9, Microti, Orygis, Bovis, La4, Caprae |
RD7tb |
100% | L6, L9, Microti, Orygis, Bovis, La4, Caprae |
This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 20 in the ORF — 0 in the essential state, 0 growth-defect, 20 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 138.2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 437 aa |
|---|---|
| Molecular weight | 46.8 kDa |
| Theoretical pI | 5.07 |
| GRAVY | 0.078 (hydrophobic) |
| Aliphatic index | 106.3 |
| Aromaticity | 0.057 |
| Instability index | 31.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MlaD | PF02470.26 | 3.4e-17 | 42–116 | MlaD protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8fee-assembly1_F |
1.00 | 0.40 | 1.0e-33 sig | 8fee-assembly1_F Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
8fef-assembly1_E |
1.00 | 0.42 | 1.6e-13 sig | 8fef-assembly1_E Structure of Mce1 transporter from Mycobacterium smegmatis (Map0) |
8fef-assembly1_D |
1.00 | 0.38 | 1.3e-14 sig | 8fef-assembly1_D Structure of Mce1 transporter from Mycobacterium smegmatis (Map0) |
8fee-assembly1_B |
1.00 | 0.41 | 5.1e-13 sig | 8fee-assembly1_B Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
8fee-assembly1_D |
1.00 | 0.37 | 7.2e-14 sig | 8fee-assembly1_D Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
Foldseek search of the AlphaFold DB model (mean pLDDT 85.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 12
| Upstream (5' on genome) | lprM (+ strand, 0 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1972 (+ strand, 21 bp gap) |
| Predicted operon |
yrbE3A · yrbE3B · mce3A · mce3B · mce3C · mce3D · lprM · mce3F · Rv1972 · Rv1973 · Rv1974 · Rv1975
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (5 TF) |
Rv0047c (activates) · Rv0081 (activates) · Rv0324 (activates) · Rv1353c (activates) · Rv1990c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: yrbE3A (integral membrane protein), high confidence from genomic context alone (score 996 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1964 yrbE3A |
integral membrane protein | 997 | 996 ctx | neighborhood:876 cooccurence:764 coexpression:815 textmining:412 |
Rv1965 yrbE3B |
integral membrane protein | 995 | 995 ctx | neighborhood:799 cooccurence:771 coexpression:849 |
Rv1972 |
Mce associated membrane protein | 994 | 994 ctx | neighborhood:851 cooccurence:755 coexpression:860 |
Rv1967 mce3B |
Mce family protein Mce3B | 996 | 993 ctx | neighborhood:795 cooccurence:774 coexpression:860 textmining:566 |
Rv1966 mce3A |
Mce family protein Mce3A | 995 | 993 ctx | neighborhood:787 cooccurence:774 coexpression:860 textmining:443 |
Rv1970 lprM |
Mce family lipoprotein LprM | 994 | 993 ctx | neighborhood:789 cooccurence:774 coexpression:860 |
Rv1969 mce3D |
Mce family protein Mce3D | 998 | 992 ctx | neighborhood:786 cooccurence:774 coexpression:857 textmining:778 |
Rv1968 mce3C |
Mce family protein Mce3C | 990 | 988 ctx | neighborhood:881 coexpression:860 |
Rv1973 |
Mce associated membrane protein | 976 | 976 ctx | neighborhood:721 cooccurence:608 coexpression:801 |
Rv1974 |
membrane protein | 956 | 956 ctx | neighborhood:839 coexpression:738 |
Rv0655 mkl exp |
ABC transporter ATP-binding protein | 940 | 900 ctx | cooccurence:759 experimental:431 textmining:424 |
Rv0168 yrbE1B |
membrane protein | 907 | 881 ctx | cooccurence:770 |
Rv3500c yrbE4B |
integral membrane protein | 902 | 875 ctx | cooccurence:772 |
Rv0588 yrbE2B hyp |
hypothetical protein | 901 | 874 ctx | cooccurence:770 |
Rv3501c yrbE4A |
integral membrane protein | 874 | 872 ctx | cooccurence:768 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: Mce family protein Mce3F
- MTBC0 PGAP product: MlaD family protein
- Pfam (hmmscan --cut_ga): MlaD PF02470.26 (E=3e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216487.1)
- Domains: Pfam-A via hmmscan --cut_ga — MlaD (PF02470.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1463 - Curated reference: UniProt O53972 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
47 functional partner(s); context anchor
yrbE3A - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002087|Rv1971|mce3F MLHLPRRVIVQLAVFTVIAVGVLAITFLHFVRLPAMLFGVGRYTVTMELVEAGGLYRTGNVTYRGFEVGRVAAVRLTDTGVQAVLALKSGIDIPSDLKAEVHSHTAIGETYVELLPRNAASPPLKNGDVIALADTSVPPDINDLLSAANTALEAIPHENLQTVIDESYTAVAGLGLELSRLIKGSAELAIDARANLDPLVALIDRAGPVLDSQTHTSDAIAAWAAQLAAVTGQLQTHDSAVGDLIDRGGPALGETRQLLERLQPTVPILLANLVSVGQVALTYHNDIEQLLVVFPMAIAAEQAGILANLNTKQAYRGQYLSFNLNLNLPPPCTTGFLPAQQRRIPTFEDYPDRPAGDLYCRVPQDSPFNVRGARNIPCETVPGKRAPTVKLCESDEPYLPLNDGYNWKGDPNATVPGLGSGQDIPQTWQTMLLPPGS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mce3F? Email the maintainer — the message is pre-filled with this gene's details.