mazE9 Resolved · medium auto-curated

H37Rv Rv2801A · MTBC0 - · 76 aa · 3110507–3110737 (-) · RefSeq YP_007411507.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin MazE9
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin MazE9.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P0CL61 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin MazE9
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis neutralizes the effect of cognate toxin MazF9.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionaddiction module antidote protein, CC2985 family
Orthologous groupCOG3609
Gene Ontology (10) GO:0003674, GO:0005488, GO:0005515, GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007, GO:0097351

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.328 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazF9 (mRNA interferase MazF9), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2801c mazF9 mRNA interferase MazF9 999 1000 ctx neighborhood:882 cooccurence:767 experimental:999 textmining:655
Rv0456A mazF1 toxin MazF1 992 992 ctx cooccurence:774 experimental:960
Rv2063A mazF7 mRNA interferase MazF7 943 939 ctx cooccurence:694 experimental:793
Rv1991c mazF6 mRNA interferase MazF6 844 785 experimental:677
Rv1942c mazF5 toxin MazF5 803 782 ctx cooccurence:686
Rv1959c parE1 toxin ParE1 774 764 experimental:756
Rv3098A PemK-like protein 676 672 ctx cooccurence:528
Rv2802c arginine/hypothetical protein 665 665 ctx neighborhood:665
Rv0960 vapC9 ribonuclease VapC9 609 610 ctx cooccurence:609
Rv0659c mazF2 toxin MazF2 629 579
Rv1102c mazF3 mRNA interferase MazF3 568 563
Rv1720c vapC12 ribonuclease VapC12 538 539 ctx cooccurence:538
Rv0065 vapC1 ribonuclease VapC1 508 494 ctx cooccurence:493
Rv2803 hyp hypothetical protein 485 484 ctx neighborhood:484
Rv3384c vapC46 ribonuclease VapC46 463 463 ctx cooccurence:462

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE9
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007411507.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3609
  • Curated reference: UniProt P0CL61 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor mazF9
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2801A|mazE9
MKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRYPTLEDDYANAWQEWSAAGDTDAWEQTVGDGVGDAPR