mazE9 Resolved · medium auto-curated
H37Rv Rv2801A · MTBC0 - ·
76 aa · 3110507–3110737 (-) ·
RefSeq YP_007411507.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE9 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Antitoxin MazE9. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P0CL61
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Antitoxin MazE9 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis neutralizes the effect of cognate toxin MazF9. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | addiction module antidote protein, CC2985 family |
| Orthologous group | COG3609 |
| Gene Ontology (10) |
GO:0003674, GO:0005488, GO:0005515, GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007, GO:0097351
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.328 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF9 (mRNA interferase MazF9), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2801c mazF9 |
mRNA interferase MazF9 | 999 | 1000 ctx | neighborhood:882 cooccurence:767 experimental:999 textmining:655 |
Rv0456A mazF1 |
toxin MazF1 | 992 | 992 ctx | cooccurence:774 experimental:960 |
Rv2063A mazF7 |
mRNA interferase MazF7 | 943 | 939 ctx | cooccurence:694 experimental:793 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 844 | 785 | experimental:677 |
Rv1942c mazF5 |
toxin MazF5 | 803 | 782 ctx | cooccurence:686 |
Rv1959c parE1 |
toxin ParE1 | 774 | 764 | experimental:756 |
Rv3098A |
PemK-like protein | 676 | 672 ctx | cooccurence:528 |
Rv2802c |
arginine/hypothetical protein | 665 | 665 ctx | neighborhood:665 |
Rv0960 vapC9 |
ribonuclease VapC9 | 609 | 610 ctx | cooccurence:609 |
Rv0659c mazF2 |
toxin MazF2 | 629 | 579 | |
Rv1102c mazF3 |
mRNA interferase MazF3 | 568 | 563 | |
Rv1720c vapC12 |
ribonuclease VapC12 | 538 | 539 ctx | cooccurence:538 |
Rv0065 vapC1 |
ribonuclease VapC1 | 508 | 494 ctx | cooccurence:493 |
Rv2803 hyp |
hypothetical protein | 485 | 484 ctx | neighborhood:484 |
Rv3384c vapC46 |
ribonuclease VapC46 | 463 | 463 ctx | cooccurence:462 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE9
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007411507.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3609 - Curated reference: UniProt P0CL61 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
28 functional partner(s); context anchor
mazF9 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2801A|mazE9 MKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRYPTLEDDYANAWQEWSAAGDTDAWEQTVGDGVGDAPR