mazE3 Resolved · medium auto-curated

H37Rv Rv1103c · MTBC0 - · 106 aa · 1230971–1231291 (-) · RefSeq NP_215619.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin MazE3
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin MazE3.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53451 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin MazE3
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis neutralizes the effect of cognate toxin MazF3. Overexpression of MazE3 alone decreased persister cells formation in M.smegmatis upon challenge with gentamicin or kanamycin.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2EG7B
Gene Ontology (8) GO:0008150, GO:0040008, GO:0045926, GO:0045927, GO:0048518, GO:0048519, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazF3 (mRNA interferase MazF3), high confidence from genomic context alone (score 916 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1102c mazF3 mRNA interferase MazF3 960 916 ctx neighborhood:882 textmining:546
Rv1959c parE1 toxin ParE1 774 764 experimental:756
Rv1104 Rv1104, (MTV017.57), len: 229 aa. Possible para-nitrobenzyl esterase (fragment; possibly first part). Similar to the N-terminal domain of ma 621 620 ctx neighborhood:620
Rv1101c hyp hypothetical protein 529 528 ctx neighborhood:528
Rv1991c mazF6 mRNA interferase MazF6 762 334 textmining:659
Rv2063A mazF7 mRNA interferase MazF7 814 333 textmining:734
Rv2801c mazF9 mRNA interferase MazF9 664 333 textmining:518
Rv0268c hyp hypothetical protein 810 76 textmining:803
Rv2022c higB2 hyp hypothetical protein 804 50 textmining:803
Rv0660c mazE2 antitoxin MazE2 870 46 textmining:870
Rv3384c vapC46 ribonuclease VapC46 806 43 textmining:806
Rv0065 vapC1 ribonuclease VapC1 549 43 textmining:549
Rv1991A mazE6 antitoxin MazE6 871 41 textmining:871
Rv2274A mazE8 antitoxin MazE8 869 41 textmining:869
Rv0456B mazE1 antitoxin MazE1 658 41 textmining:658

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE3
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215619.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EG7B
  • Curated reference: UniProt O53451 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor mazF3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1103c|mazE3
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEILATNTSATGDLDTLAGHCARTALDID