mazE3 Resolved · medium auto-curated
H37Rv Rv1103c · MTBC0 - ·
106 aa · 1230971–1231291 (-) ·
RefSeq NP_215619.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE3 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Antitoxin MazE3. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O53451
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Antitoxin MazE3 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis neutralizes the effect of cognate toxin MazF3. Overexpression of MazE3 alone decreased persister cells formation in M.smegmatis upon challenge with gentamicin or kanamycin. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2EG7B |
|---|---|
| Gene Ontology (8) |
GO:0008150, GO:0040008, GO:0045926, GO:0045927, GO:0048518, GO:0048519, GO:0050789, GO:0065007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF3 (mRNA interferase MazF3), high confidence from genomic context alone (score 916 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1102c mazF3 |
mRNA interferase MazF3 | 960 | 916 ctx | neighborhood:882 textmining:546 |
Rv1959c parE1 |
toxin ParE1 | 774 | 764 | experimental:756 |
Rv1104 |
Rv1104, (MTV017.57), len: 229 aa. Possible para-nitrobenzyl esterase (fragment; possibly first part). Similar to the N-terminal domain of ma | 621 | 620 ctx | neighborhood:620 |
Rv1101c hyp |
hypothetical protein | 529 | 528 ctx | neighborhood:528 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 762 | 334 | textmining:659 |
Rv2063A mazF7 |
mRNA interferase MazF7 | 814 | 333 | textmining:734 |
Rv2801c mazF9 |
mRNA interferase MazF9 | 664 | 333 | textmining:518 |
Rv0268c hyp |
hypothetical protein | 810 | 76 | textmining:803 |
Rv2022c higB2 hyp |
hypothetical protein | 804 | 50 | textmining:803 |
Rv0660c mazE2 |
antitoxin MazE2 | 870 | 46 | textmining:870 |
Rv3384c vapC46 |
ribonuclease VapC46 | 806 | 43 | textmining:806 |
Rv0065 vapC1 |
ribonuclease VapC1 | 549 | 43 | textmining:549 |
Rv1991A mazE6 |
antitoxin MazE6 | 871 | 41 | textmining:871 |
Rv2274A mazE8 |
antitoxin MazE8 | 869 | 41 | textmining:869 |
Rv0456B mazE1 |
antitoxin MazE1 | 658 | 41 | textmining:658 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE3
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215619.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EG7B - Curated reference: UniProt O53451 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
mazF3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1103c|mazE3 MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEILATNTSATGDLDTLAGHCARTALDID