vapC22 Family assigned · medium auto-curated

H37Rv Rv2829c · MTBC0 mtbc0_003008 · 130 aa · 3157286–3157678 (-) · RefSeq NP_217345.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC22
MTBC0 PGAP re-annotationPIN domain-containing protein
Revised (this work)PIN domain-containing protein. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71623 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC22
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase (By similarity). Upon expression in M.smegmatis inhibits translation and colony formation. Its toxic effect on colony formation is neutralized by coexpression with cognate antitoxin VapB22; the effect on translation has not been tested but is probably neutralized also.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionribonuclease activity
Orthologous groupCOG3744
Gene Ontology (36) GO:0005575, GO:0005576, GO:0006417, GO:0008150, GO:0009889, GO:0009890, GO:0009892, GO:0010468, GO:0010556, GO:0010558, GO:0010605, GO:0010608 +24 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.116 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.40% of strains (577) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 8.1e-214–120 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB22 (antitoxin VapB22), high confidence from genomic context alone (score 889 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2830c vapB22 antitoxin VapB22 921 889 ctx neighborhood:882
Rv2828A hyp hypothetical protein 786 787 ctx neighborhood:787
Rv2828c hyp hypothetical protein 755 754 ctx neighborhood:751
Rv2831 echA16 enoyl-CoA hydratase EchA16 822 652 ctx neighborhood:647 textmining:511
Rv2827c hyp hypothetical protein 434 417
Rv2826c hyp hypothetical protein 416 403
Rv2494 vapC38 ribonuclease VapC38 485 313
Rv2548 vapC19 ribonuclease VapC19 511 308
Rv1561 vapC11 ribonuclease VapC11 544 304
Rv2010 vapC15 ribonuclease VapC15 482 301
Rv2530c vapC39 ribonuclease VapC39 485 288
Rv3320c vapC44 ribonuclease VapC44 501 277
Rv2801c mazF9 mRNA interferase MazF9 508 245
Rv1102c mazF3 mRNA interferase MazF3 402 191
Rv0609 vapC28 ribonuclease VapC28 514 185 textmining:429

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC22
  • MTBC0 PGAP product: PIN domain-containing protein
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=8e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217345.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3744
  • Curated reference: UniProt P71623 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor vapB22
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003008|Rv2829c|vapC22
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSVAATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW