mazE4 Resolved · medium auto-curated
H37Rv Rv1494 · MTBC0 mtbc0_001598 ·
100 aa · 1696076–1696378 (+) ·
RefSeq NP_216010.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE4 |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system antitoxin MazE4 |
| Revised (this work) | Type II toxin-antitoxin system antitoxin MazE4. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJ91
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable antitoxin MazE4 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. In M.smegmatis neutralizes the toxic effect of mRNA interferase MazF4, its cognate toxin, on growth. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2BSKF |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.813 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF4 (mRNA interferase MazF4), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1495 mazF4 |
mRNA interferase MazF4 | 999 | 1000 ctx | neighborhood:882 experimental:999 textmining:594 |
Rv1496 meaB |
transport system kinase | 803 | 802 ctx | neighborhood:801 |
Rv1493 mutB |
methylmalonyl-CoA mutase large subunit | 840 | 774 ctx | neighborhood:772 |
Rv1492 mutA |
methylmalonyl-CoA mutase small subunit | 775 | 774 ctx | neighborhood:772 |
Rv1497 lipL |
esterase LipL | 622 | 621 ctx | neighborhood:619 |
Rv1491c |
TVP38/TMEM64 family membrane protein | 500 | 501 ctx | neighborhood:499 |
Rv1942c mazF5 |
toxin MazF5 | 404 | 405 | |
Rv1991c mazF6 |
mRNA interferase MazF6 | 477 | 400 | |
Rv1943c mazE5 |
antitoxin MazE5 | 635 | 55 | textmining:630 |
Rv2493 vapB38 |
antitoxin VapB38 | 550 | 55 | textmining:544 |
Rv3321c vapB44 |
antitoxin VapB44 | 527 | 53 | textmining:522 |
Rv2547 vapB19 |
antitoxin VapB19 | 579 | 50 | textmining:576 |
Rv2075c hyp |
hypothetical protein | 406 | 47 | textmining:403 |
Rv1114 vapC32 |
ribonuclease VapC32 | 654 | 46 | textmining:653 |
Rv0301 vapC2 |
ribonuclease VapC2 | 517 | 46 | textmining:515 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antitoxin MazE4
- MTBC0 PGAP product: type II toxin-antitoxin system antitoxin MazE4
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216010.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BSKF - Curated reference: UniProt P9WJ91 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
mazF4 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001598|Rv1494|mazE4 MPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYESEAERSAARARRNARQQRSAQ