vapB18 Family assigned · medium auto-curated

H37Rv Rv2545 · MTBC0 mtbc0_002712 · 92 aa · 2891328–2891606 (+) · RefSeq NP_217061.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB18
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapB family antitoxin
Revised (this work)Type II toxin-antitoxin system VapB family antitoxin. Pfam: VapB_antitoxin (PF09957.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ47 SwissProt · reviewed · Predicted
UniProt namePutative antitoxin VapB18
Curated functionPutative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC18.

UniProt still lists this protein as Putative antitoxin VapB18; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionpositive regulation of growth
Orthologous groupCOG5450

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 25.77% of strains (37424) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VapB_antitoxinPF09957.16 2.6e-0557–89 Bacterial antitoxin of type II TA system, VapB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC18 (ribonuclease VapC18), high confidence from genomic context alone (score 817 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2546 vapC18 ribonuclease VapC18 816 817 ctx neighborhood:768
Rv2544 lppB lipoprotein LppB 810 810 ctx neighborhood:801
Rv2543 lppA lipoprotein LppA 783 783 ctx neighborhood:781
Rv2548 vapC19 ribonuclease VapC19 588 589 ctx neighborhood:508
Rv2547 vapB19 antitoxin VapB19 811 511 ctx neighborhood:508 textmining:630
Rv2542 hyp hypothetical protein 504 505 ctx neighborhood:502
Rv0301 vapC2 ribonuclease VapC2 718 217 textmining:655
Rv1114 vapC32 ribonuclease VapC32 717 212 textmining:656
Rv0960 vapC9 ribonuclease VapC9 418 55 textmining:410
Rv3321c vapB44 antitoxin VapB44 676 46 textmining:675
Rv1943c mazE5 antitoxin MazE5 803 44 textmining:803
Rv2493 vapB38 antitoxin VapB38 660 44 textmining:659
Rv1494 mazE4 antitoxin MazE4 656 44 textmining:655
Rv2494 vapC38 ribonuclease VapC38 527 44 textmining:526
Rv2651c prophage protease 432 44 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB18
  • MTBC0 PGAP product: type II toxin-antitoxin system VapB family antitoxin
  • Pfam (hmmscan --cut_ga): VapB_antitoxin PF09957.16 (E=3e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217061.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VapB_antitoxin (PF09957.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5450
  • Curated reference: UniProt P9WJ47 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor vapC18
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002712|Rv2545|vapB18
MSTTIVAGVIQGHLPVILPTRRRARDLGHTTALFRAQTLQCIYLSIEYLYVCSMSRRTTIDIDDILLARAQAALGTTGLKDRVDAALRAAVR