vapB19 Family assigned · medium auto-curated

H37Rv Rv2547 · MTBC0 mtbc0_002714 · 85 aa · 2892151–2892408 (+) · RefSeq NP_217063.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB19
MTBC0 PGAP re-annotationCopG family transcriptional regulator
Revised (this work)CopG family transcriptional regulator. Pfam: RHH_1 (PF01402.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95006 SwissProt · reviewed · Evidence at protein level
UniProt namePutative antitoxin VapB19
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC19.

UniProt still lists this protein as Putative antitoxin VapB19; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionRibbon-helix-helix protein, copG family
Orthologous group2BT7R

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.37 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RHH_1PF01402.28 3.9e-121–38 Ribbon-helix-helix protein, copG family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC19 (ribonuclease VapC19), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2548 vapC19 ribonuclease VapC19 941 884 ctx neighborhood:882 textmining:518
Rv2546 vapC18 ribonuclease VapC18 740 740 ctx neighborhood:739
Rv2545 vapB18 antitoxin VapB18 811 511 ctx neighborhood:508 textmining:630
Rv2544 lppB lipoprotein LppB 475 476 ctx neighborhood:473
Rv2543 lppA lipoprotein LppA 461 461 ctx neighborhood:458
Rv3321c vapB44 antitoxin VapB44 807 64 textmining:803
Rv2493 vapB38 antitoxin VapB38 635 55 textmining:630
Rv2550c vapB20 antitoxin VapB20 634 53 textmining:630
Rv0599c vapB27 antitoxin VapB27 517 51 textmining:512
Rv1494 mazE4 antitoxin MazE4 579 50 textmining:576
Rv0623 vapB30 antitoxin VapB30 515 50 textmining:511
Rv3320c vapC44 ribonuclease VapC44 416 50 textmining:411
Rv2530A vapB39 antitoxin VapB39 552 47 textmining:550
Rv0608 vapB28 antitoxin VapB28 521 47 textmining:518
Rv2601A vapB41 antitoxin VapB41 444 47 textmining:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB19
  • MTBC0 PGAP product: CopG family transcriptional regulator
  • Pfam (hmmscan --cut_ga): RHH_1 PF01402.28 (E=4e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217063.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RHH_1 (PF01402.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BT7R
  • Curated reference: UniProt P95006 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor vapC19
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002714|Rv2547|vapB19
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLARLGLA