vapC2 Family assigned · medium auto-curated

H37Rv Rv0301 · MTBC0 mtbc0_000320 · 141 aa · 367383–367808 (+) · RefSeq NP_214815.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC2
MTBC0 PGAP re-annotationPIN domain nuclease
Revised (this work)PIN domain nuclease. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFB9 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC2
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Acts as an RNase. Upon expression in M.smegmatis inhibits translation, growth and colony formation. All its toxic effects are neutralized by coexpression with cognate antitoxin VapB2.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1487
Gene Ontology (57) GO:0003674, GO:0003824, GO:0004518, GO:0004540, GO:0006139, GO:0006417, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0009889, GO:0009890 +45 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.352 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.65% of strains (945) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 4.4e-147–125 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB2 (antitoxin VapB2), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0300 vapB2 antitoxin VapB2 999 1000 ctx neighborhood:882 experimental:999 textmining:870
Rv0299 toxin 683 683 ctx neighborhood:667
Rv0298 antitoxin 675 675 ctx neighborhood:667
Rv0302 transcriptional regulator 593 593 ctx neighborhood:520
Rv0303 dehydrogenase/reductase 504 504 ctx neighborhood:504
Rv0297 PE_PGRS5 PE-PGRS family protein PE_PGRS5 417 417 ctx neighborhood:417
Rv2601A vapB41 antitoxin VapB41 434 412
Rv3407 vapB47 antitoxin VapB47 411 411
Rv1952 vapB14 antitoxin VapB14 431 408
Rv2010 vapC15 ribonuclease VapC15 636 281 textmining:515
Rv0626 vapB5 antitoxin VapB5 847 260 textmining:803
Rv2009 vapB15 antitoxin VapB15 643 240 textmining:550
Rv2545 vapB18 antitoxin VapB18 718 217 textmining:655
Rv0960 vapC9 ribonuclease VapC9 400 214
Rv1114 vapC32 ribonuclease VapC32 600 204 textmining:519

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC2
  • MTBC0 PGAP product: PIN domain nuclease
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=4e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214815.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1487
  • Curated reference: UniProt P9WFB9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor vapB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000320|Rv0301|vapC2
MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA