lprB Still unknown · low auto-curated

H37Rv Rv1274 · MTBC0 mtbc0_001364 · 185 aa · 1433180–1433737 (+) · RefSeq NP_215790.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LprB
MTBC0 PGAP re-annotationDUF3558 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3558. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK53 SwissProt · reviewed · Evidence at protein level
UniProt namePutative lipoprotein LprB

UniProt still lists this protein as Putative lipoprotein LprB; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namelprB
eggNOG descriptionProtein of unknown function (DUF3558)
Orthologous groupCOG1188
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3558PF12079.14 7.7e-3421–183 Protein of unknown function (DUF3558)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lprC (lipoprotein LprC), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1275 lprC lipoprotein LprC 999 994 ctx neighborhood:882 cooccurence:774 coexpression:802 textmining:852
Rv2904c rplS 50S ribosomal protein L19 925 925 coexpression:416 experimental:867
Rv1643 rplT 50S ribosomal protein L20 871 872 experimental:865
Rv3456c rplQ 50S ribosomal protein L17 883 870 experimental:865
Rv3443c rplM 50S ribosomal protein L13 869 870 experimental:868
Rv0714 rplN 50S ribosomal protein L14 869 869 experimental:868
Rv2441c rpmA 50S ribosomal protein L27 869 869 experimental:865
Rv2442c rplU 50S ribosomal protein L21 868 869 experimental:865
Rv0706 rplV 50S ribosomal protein L22 867 868 experimental:867
Rv0719 rplF 50S ribosomal protein L6 866 867 experimental:865
Rv0704 rplB 50S ribosomal protein L2 870 866 experimental:865
Rv0703 rplW 50S ribosomal protein L23 866 866 experimental:865
Rv0701 rplC 50S ribosomal protein L3 866 866 experimental:865
Rv1642 rpmI 50S ribosomal protein L35 866 866 experimental:865
Rv0715 rplX 50S ribosomal protein L24 866 866 experimental:865

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LprB
  • MTBC0 PGAP product: DUF3558 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF3558 PF12079.14 (E=8e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215790.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3558 (PF12079.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1188
  • Curated reference: UniProt P9WK53 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 174 functional partner(s); context anchor lprC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001364|Rv1274|lprB
MRRKVRRLTLAVSALVALFPAVAGCSDSGDNKPGATIPSTPANAEGRHGPFFPQCGGVSDQTVTELTRVTGLVNTAKNSVGCQWLAGGGILGPHFSFSWYRGSPIGRERKTEELSRASVEDINIDGHSGFIAIGNEPSLGDSLCEVGIQFSDDFIEWSVSFSQKPFPPPCDIAKELTRQSIANSK