Rv1125 Family assigned · medium auto-curated

H37Rv Rv1125 · MTBC0 mtbc0_001208 · 414 aa · 1256522–1257766 (+) · RefSeq NP_215641.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationWS/DGAT domain-containing protein
Revised (this work)WS/DGAT domain-containing protein. Pfam: WS_DGAT_C (PF06974.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06577 TrEMBL · unreviewed · Evidence at protein level
UniProt nameO-acyltransferase WSD1 C-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionD-alanine [D-alanyl carrier protein] ligase activity
Orthologous groupCOG1020

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.479 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WS_DGAT_CPF06974.19 3.1e-08270–413 WS/DGAT C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ephC (epoxide hydrolase EphC), high confidence from genomic context alone (score 903 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1124 ephC epoxide hydrolase EphC 903 903 ctx neighborhood:881
Rv3800c pks13 polyketide synthase 872 847 coexpression:647 experimental:465
Rv2048c pks12 polyketide synthase 845 821 coexpression:456 experimental:642
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 844 821 coexpression:453 experimental:642
Rv1527c pks5 polyketide synthase 844 821 coexpression:456 experimental:642
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 844 821 coexpression:455 experimental:642
Rv2940c mas multifunctional mycocerosic acid synthase 844 821 coexpression:453 experimental:642
Rv0383c ttfA hyp hypothetical protein 807 798 ctx cooccurence:764
Rv2876 transmembrane protein 770 770 ctx cooccurence:770
Rv3035 hyp hypothetical protein 767 767 ctx cooccurence:766
Rv1610 membrane protein 766 766 ctx cooccurence:764
Rv1274 lprB lipoprotein LprB 758 759 ctx cooccurence:758
Rv1836c hyp hypothetical protein 753 753 ctx cooccurence:752
Rv2326c ABC transporter ATP-binding protein 761 752 ctx cooccurence:750
Rv1203c hyp hypothetical protein 756 751 ctx cooccurence:750

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: WS/DGAT domain-containing protein
  • Pfam (hmmscan --cut_ga): WS_DGAT_C PF06974.19 (E=3e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215641.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_C (PF06974.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1020
  • Curated reference: UniProt O06577 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 141 functional partner(s); context anchor ephC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001208|Rv1125|
MAGHRMAAVDAQFYWMSAKVPNDQFLLYAFDGEPTDLERAVAQVYRRARGCPGLGMRVQDRGALAYPQWVPTPVQRDQLVCHDLADRSWQGCLAAVVGLAGKQLDMRRMPWRLHVFTPVHDVPGVSGLGTVAVMQFAHALGDGARASAMAAWLFGRPAAVPEIARSRAGFLPWRAAHAARAHLRLVRDTNAGLVAPGVGSRPPLSTNARPEGVRAVRTLLRRRSQLAGPTVTVTVLAAVSTGLLGLLGGDVDTLGAEVPMAKPGVPRSYNHFGNVVVGLYPRLEPDERVRRIATDLANARRRFEHPAMLSADRAFAAVPAALLRWGVSQFDAEVRPVRVAGNTVVSSVYRGAADLSFGDAPVVLTAGYPALSPAMGLTHGVHGIGDTVAISVHAAESAVSDIDAYMRLLDAALQ