Rv1125 Family assigned · medium auto-curated
H37Rv Rv1125 · MTBC0 mtbc0_001208 ·
414 aa · 1256522–1257766 (+) ·
RefSeq NP_215641.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | WS/DGAT domain-containing protein |
| Revised (this work) | WS/DGAT domain-containing protein. Pfam: WS_DGAT_C (PF06974.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06577
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | O-acyltransferase WSD1 C-terminal domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | D-alanine [D-alanyl carrier protein] ligase activity |
| Orthologous group | COG1020 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.479 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WS_DGAT_C | PF06974.19 | 3.1e-08 | 270–413 | WS/DGAT C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ephC (epoxide hydrolase EphC), high confidence from genomic context alone (score 903 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1124 ephC |
epoxide hydrolase EphC | 903 | 903 ctx | neighborhood:881 |
Rv3800c pks13 |
polyketide synthase | 872 | 847 | coexpression:647 experimental:465 |
Rv2048c pks12 |
polyketide synthase | 845 | 821 | coexpression:456 experimental:642 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 844 | 821 | coexpression:453 experimental:642 |
Rv1527c pks5 |
polyketide synthase | 844 | 821 | coexpression:456 experimental:642 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 844 | 821 | coexpression:455 experimental:642 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 844 | 821 | coexpression:453 experimental:642 |
Rv0383c ttfA hyp |
hypothetical protein | 807 | 798 ctx | cooccurence:764 |
Rv2876 |
transmembrane protein | 770 | 770 ctx | cooccurence:770 |
Rv3035 hyp |
hypothetical protein | 767 | 767 ctx | cooccurence:766 |
Rv1610 |
membrane protein | 766 | 766 ctx | cooccurence:764 |
Rv1274 lprB |
lipoprotein LprB | 758 | 759 ctx | cooccurence:758 |
Rv1836c hyp |
hypothetical protein | 753 | 753 ctx | cooccurence:752 |
Rv2326c |
ABC transporter ATP-binding protein | 761 | 752 ctx | cooccurence:750 |
Rv1203c hyp |
hypothetical protein | 756 | 751 ctx | cooccurence:750 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: WS/DGAT domain-containing protein
- Pfam (hmmscan --cut_ga): WS_DGAT_C PF06974.19 (E=3e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215641.1)
- Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_C (PF06974.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1020 - Curated reference: UniProt O06577 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
141 functional partner(s); context anchor
ephC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001208|Rv1125| MAGHRMAAVDAQFYWMSAKVPNDQFLLYAFDGEPTDLERAVAQVYRRARGCPGLGMRVQDRGALAYPQWVPTPVQRDQLVCHDLADRSWQGCLAAVVGLAGKQLDMRRMPWRLHVFTPVHDVPGVSGLGTVAVMQFAHALGDGARASAMAAWLFGRPAAVPEIARSRAGFLPWRAAHAARAHLRLVRDTNAGLVAPGVGSRPPLSTNARPEGVRAVRTLLRRRSQLAGPTVTVTVLAAVSTGLLGLLGGDVDTLGAEVPMAKPGVPRSYNHFGNVVVGLYPRLEPDERVRRIATDLANARRRFEHPAMLSADRAFAAVPAALLRWGVSQFDAEVRPVRVAGNTVVSSVYRGAADLSFGDAPVVLTAGYPALSPAMGLTHGVHGIGDTVAISVHAAESAVSDIDAYMRLLDAALQ