Rv1100 Still unknown · low auto-curated

H37Rv Rv1100 · MTBC0 - · 233 aa · 1228683–1229384 (+) · RefSeq NP_215616.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4245. Function unknown. Foldseek best (non-significant) hit: 2p4b-assembly1_B Crystal structure of E.coli RseB (prob 0.41, TM 0.41).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53448 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF4245)
Orthologous group2E5JR

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.716 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4245PF14030.12 9.2e-5234–223 Protein of unknown function (DUF4245)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 93.1 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2p4b-assembly1_B 0.41 0.41 4.3e-01 2p4b-assembly1_B Crystal structure of E.coli RseB
4fpw-assembly3_B 0.23 0.25 5.4e-02 4fpw-assembly3_B Crystal Structure of CalU16 from Micromonospora echinospora. Northeast Structural Genomics Consortium Target MiR12.
8f2u-assembly1_J 0.18 0.54 2.5e+00 8f2u-assembly1_J Human CCC complex
8iex-assembly1_A 0.16 0.52 2.3e+00 8iex-assembly1_A Solution structure of AtWRKY11-DBD
3pu2-assembly3_C 0.16 0.22 6.0e-02 3pu2-assembly3_C Crystal Structure of the Q3J4M4_RHOS4 protein from Rhodobacter sphaeroides. Northeast Structural Genomics Consortium Target RhR263.
4fpw-assembly3_A 0.16 0.26 1.2e-01 4fpw-assembly3_A Crystal Structure of CalU16 from Micromonospora echinospora. Northeast Structural Genomics Consortium Target MiR12.
6pny-assembly1_A 0.15 0.38 1.0e+00 6pny-assembly1_A X-ray Structure of Flpp3
3rd6-assembly2_B-2 0.14 0.30 4.6e-01 3rd6-assembly2_B-2 Crystal structure of Mll3558 protein from Rhizobium loti. Northeast Structural Genomics Consortium target id MlR403

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2732c (transmembrane protein), high confidence from genomic context alone (score 754 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0038 hyp hypothetical protein 763 764 coexpression:730
Rv1019 transcriptional regulator 759 759 coexpression:759
Rv1488 hyp hypothetical protein 757 757 coexpression:757
Rv2732c transmembrane protein 753 754 ctx cooccurence:750
Rv1098c fum fumarate hydratase 751 751 ctx neighborhood:747
Rv1610 membrane protein 747 748 ctx cooccurence:746
Rv3802c membrane protein 742 743 ctx cooccurence:739
Rv0358 hyp hypothetical protein 742 742 ctx cooccurence:742
Rv0010c membrane protein 734 734 ctx cooccurence:733
Rv0903c prrA two component transcriptional regulator PrrA 734 734 coexpression:734
Rv2788 sirR transcriptional repressor SirR 733 733 coexpression:733
Rv3792 aftA arabinofuranosyltransferase 733 733 ctx cooccurence:733
Rv3668c protease 731 731 ctx cooccurence:731
Rv0377 HTH-type transcriptional regulator 729 729 coexpression:729
Rv2171 lppM lipoprotein LppM 720 720 ctx cooccurence:720

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF4245 PF14030.12 (E=9e-52)
  • Foldseek best: 2p4b-assembly1_B Crystal structure of E.coli RseB (prob 0.41, E=4e-01, TM=0.41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215616.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4245 (PF14030.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E5JR
  • Curated reference: UniProt O53448 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 93.1, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 101 functional partner(s); context anchor Rv2732c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1100|
MVGDCPRSRTVRWSWDTGHVTAEPQPTPRPAKPRLLQDGRDMFWSLAPLVVGCILLAGLVGMCSFQLGGTKRGPIPSYDAAQALRADAKTLGFPIRLPQLPGGWTPNSGGRGGIENGRADPATGQRRNAATSIVGFISPTGRYLSLTQSNADEDKLVGSIHPSMYPTGTVDVGGTRWVVYEGSDENGAVEPVWTTRLTGPGGATQLAITGAGSIDQFRTLASATQSQPPLPAR