Rv1100 Family assigned · low

H37Rv Rv1100 · MTBC0 - · 233 aa · 1228683–1229384 H37Rv (+) · RefSeq NP_215616.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Candidate anti-sigma-factor regulatory protein of the RseB/MucB family (envelope-stress ECF-sigma-factor regulation): the two top HHpred hits are RseB (sigma-E regulator) 93.65% and MucB (AlgU regulator) 89.1%, the same anti-sigma-regulator family, clearly above the membrane-protein noise floor. CAVEAT: E-values modest (2.5/14), and there is NO STRING/genomic corroboration with any sigma/anti-sigma system; Rv1100 is a 1-TM membrane protein (vs periplasmic RseB) under relaxed selection. Fold-level candidate, function uncertain. RefSeq leaves this locus uncharacterised.
Functional category (TubercuList)conserved hypotheticals

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder32% of residues (metapredict) · mean AlphaFold pLDDT 86.0
Disordered regions2 IDR(s), longest 39 aa [0-39, 94-119]

carries a substantial disordered region (64/233 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Phenotype-driven functional lead (hypothesis) priority 8.0

disruption sensitises to Isoniazid (cell-envelope / intrinsic drug tolerance); required for fitness in vivo (virulence / persistence factor); predicted membrane protein.

Corroborating evidenceconserved / under constraint intra-MTBC; STRING-coupled to Rv2732c (transmembrane protein); structural lead available

This locus is a "hypothetical" with a conditional Tn-seq phenotype. The statement above is a working hypothesis for its functional context, synthesised from the phenotype pattern and the corroborating layers on this page (conservation, STRING coupling, operon, regulon, localisation, structure) — a prioritised requalification candidate to validate, not an established function.

Genomic-neighbour overlap (structural caveat) antiparallel · 0 % of gene

NeighbourglpX (Rv1099c, - strand)
Overlap2 bp, 0 % of this gene's length

antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -1.52 (95% CI -3.40 to 1.46). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1130 · 100.0% identity
M. leprae ML1945c · 63.4% identity
M. marinum MMAR_4366 · 78.5% identity
M. smegmatis MSMEG_5238 · 60.3% identity
M. orygis RJtmp_001162 · 99.5% identity
M. abscessus MAB_1252 · 50.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53448 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF4245)
Orthologous group2E5JR

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.716 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 73.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 5/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 40.3%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 46.7. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection, day 10 (in vivo) -3.480.0053 required
Mutants exhibiting altered fitness in the absence of gene marP (other) -2.620.0 required
altered fitness under Isoniazid (drug exposure) -2.440.0 required
fitness in mouse infection (in vivo) +2.280.0 disruption advantageous
fitness in mouse infection (in vivo) +2.040.012 disruption advantageous
fitness in mouse infection (in vivo) +2.020.0 disruption advantageous
fitness in mouse infection (in vivo) +2.020.005 disruption advantageous
altered fitness under Isoniazid (drug exposure) -1.990.0 required
fitness in mouse infection (in vivo) +1.670.044 disruption advantageous

Conditional fitness of transposon-disruption mutants across 9 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance79.1 ppm · rank 1461/3519 (58.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (1 TM helix)
DeepTMHMM classTM
TM helices (DeepTMHMM)1

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length233 aa
Molecular weight24.6 kDa
Theoretical pI9.21
GRAVY-0.297 (hydrophilic)
Aliphatic index73.3
Aromaticity0.064
Instability index40.1 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4245PF14030.12 9.2e-5234–223 Protein of unknown function (DUF4245)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 93.1 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2p4b-assembly1_B 0.41 0.41 4.3e-01 2p4b-assembly1_B Crystal structure of E.coli RseB
4fpw-assembly3_B 0.23 0.25 5.4e-02 4fpw-assembly3_B Crystal Structure of CalU16 from Micromonospora echinospora. Northeast Structural Genomics Consortium Target MiR12.
8f2u-assembly1_J 0.18 0.54 2.5e+00 8f2u-assembly1_J Human CCC complex
8iex-assembly1_A 0.16 0.52 2.3e+00 8iex-assembly1_A Solution structure of AtWRKY11-DBD
3pu2-assembly3_C 0.16 0.22 6.0e-02 3pu2-assembly3_C Crystal Structure of the Q3J4M4_RHOS4 protein from Rhodobacter sphaeroides. Northeast Structural Genomics Consortium Target RhR263.
4fpw-assembly3_A 0.16 0.26 1.2e-01 4fpw-assembly3_A Crystal Structure of CalU16 from Micromonospora echinospora. Northeast Structural Genomics Consortium Target MiR12.
6pny-assembly1_A 0.15 0.38 1.0e+00 6pny-assembly1_A X-ray Structure of Flpp3
3rd6-assembly2_B-2 0.14 0.30 4.6e-01 3rd6-assembly2_B-2 Crystal structure of Mll3558 protein from Rhizobium loti. Northeast Structural Genomics Consortium target id MlR403

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)glpX (- strand, -2 bp gap)
Downstream (3' on genome)Rv1101c (- strand, 6 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2732c (transmembrane protein), high confidence from genomic context alone (score 754 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0038 hyp hypothetical protein 763 764 coexpression:730
Rv1019 transcriptional regulator 759 759 coexpression:759
Rv1488 hyp hypothetical protein 757 757 coexpression:757
Rv2732c transmembrane protein 753 754 ctx cooccurence:750
Rv1098c fum fumarate hydratase 751 751 ctx neighborhood:747
Rv1610 membrane protein 747 748 ctx cooccurence:746
Rv3802c membrane protein 742 743 ctx cooccurence:739
Rv0358 hyp hypothetical protein 742 742 ctx cooccurence:742
Rv0010c membrane protein 734 734 ctx cooccurence:733
Rv0903c prrA two component transcriptional regulator PrrA 734 734 coexpression:734
Rv2788 sirR transcriptional repressor SirR 733 733 coexpression:733
Rv3792 aftA arabinofuranosyltransferase 733 733 ctx cooccurence:733
Rv3668c protease 731 731 ctx cooccurence:731
Rv0377 HTH-type transcriptional regulator 729 729 coexpression:729
Rv2171 lppM lipoprotein LppM 720 720 ctx cooccurence:720

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • HHpred: top 2 hits RseB 3M4W 93.65% E2.5 + MucB 6IN9 89.1% E14 (RseB/MucB anti-sigma-factor regulators), separated from the PufX/membrane-protein noise (<80%). Cross-check: 1-TM, no signal peptide (vs periplasmic RseB); STRING partners (Rv2732c, fum, Rv0038) and neighbours (fructose-1,6-bisphosphatase, MazF3) show NO sigma/anti-sigma link; relaxed/neutral selection. DUF4245. Propagated low with explicit caveat.
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215616.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4245 (PF14030.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E5JR
  • Curated reference: UniProt O53448 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 93.1, very high)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 86.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 101 functional partner(s); context anchor Rv2732c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1100|
MVGDCPRSRTVRWSWDTGHVTAEPQPTPRPAKPRLLQDGRDMFWSLAPLVVGCILLAGLVGMCSFQLGGTKRGPIPSYDAAQALRADAKTLGFPIRLPQLPGGWTPNSGGRGGIENGRADPATGQRRNAATSIVGFISPTGRYLSLTQSNADEDKLVGSIHPSMYPTGTVDVGGTRWVVYEGSDENGAVEPVWTTRLTGPGGATQLAITGAGSIDQFRTLASATQSQPPLPAR