Rv1575 Resolved · medium auto-curated

H37Rv Rv1575 · MTBC0 - · 166 aa · 1780199–1780699 (+) · RefSeq NP_216091.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage protein
MTBC0 PGAP re-annotation
Revised (this work)Phage protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0T9U5 TrEMBL · unreviewed · Predicted
UniProt nameProbable PhiRv1 phage protein

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 40.58% of strains (58924) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1574 (phage protein), high confidence from genomic context alone (score 807 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1574 phage protein 807 807 ctx neighborhood:773
Rv1573 phage protein 467 467 ctx neighborhood:441
Rv3869 eccB1 ESX-1 secretion system protein EccB 523 68 textmining:510
Rv0823c dusB tRNA-dihydrouridine synthase 655 55 textmining:650
Rv2790c ltp1 lipid-transfer protein 807 54 textmining:805
Rv0458 aldehyde dehydrogenase 629 54 textmining:624
Rv3170 aofH flavin-containing monoamine oxidase 805 47 textmining:804
Rv0724 sppA protease IV SppA 804 47 textmining:803
Rv1758 cut1 cutinase 440 47 textmining:437
Rv0176 Mce associated transmembrane protein 652 46 textmining:651
Rv0120c fusA2 elongation factor G 654 44 textmining:653
Rv1132 hyp hypothetical protein 808 41 textmining:808
Rv2561 Rv2561, (MTCY9C4.07c), len: 97 aa. Conserved hypothetical protein, highly similar in part (and longer 33 aa) to upstream ORF AAK46951|RV2562 807 41 textmining:807
Rv2542 hyp hypothetical protein 806 41 textmining:806
Rv2216 epimerase family protein 549 41 textmining:549

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): phage protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216091.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt L0T9U5 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv1574
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1575|
MEPKPSQRHTDKEVGAALGISAGTYKRLKRIDNATRSDDKEIRLFAEKQMAPLAAGSPSWNGRKPSSGNRKAATMAARLDILAWGPWAPSQNRSVVRRKQTLLSAQPSASPPAPTGGSNESTTQPAASWRVGGPAPLSRGRPRLALSYLRGSLHLQNSKRVAHQHI