Rv1972 Resolved · medium auto-curated

H37Rv Rv1972 · MTBC0 mtbc0_002088 · 191 aa · 2235709–2236284 (+) · RefSeq NP_216488.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)Mce associated membrane protein
MTBC0 PGAP re-annotationMce associated membrane protein
Revised (this work)Mce associated membrane protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53973 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved Mce associated membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2E5BU
KEGG orthology K18481
KEGG modules M00670

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mce3F (Mce family protein Mce3F), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1971 mce3F Mce family protein Mce3F 994 994 ctx neighborhood:851 cooccurence:755 coexpression:860
Rv1968 mce3C Mce family protein Mce3C 992 992 ctx neighborhood:851 cooccurence:742 coexpression:808
Rv1973 Mce associated membrane protein 991 992 ctx neighborhood:800 cooccurence:762 coexpression:836
Rv1970 lprM Mce family lipoprotein LprM 989 988 ctx neighborhood:721 cooccurence:753 coexpression:838
Rv1966 mce3A Mce family protein Mce3A 993 987 ctx neighborhood:714 cooccurence:767 coexpression:820 textmining:547
Rv1969 mce3D Mce family protein Mce3D 997 985 ctx neighborhood:715 cooccurence:766 coexpression:799 textmining:803
Rv1967 mce3B Mce family protein Mce3B 984 985 ctx neighborhood:729 cooccurence:712 coexpression:822
Rv1965 yrbE3B integral membrane protein 988 976 ctx neighborhood:715 cooccurence:620 coexpression:793 textmining:548
Rv1974 membrane protein 994 972 ctx neighborhood:869 coexpression:797 textmining:803
Rv1964 yrbE3A integral membrane protein 946 946 ctx neighborhood:747 cooccurence:492 coexpression:615
Rv1975 hyp hypothetical protein 928 925 ctx neighborhood:852
Rv0492c GMC-type oxidoreductase 765 756 database:536
Rv3494c mce4F Mce family protein Mce4 755 756 ctx cooccurence:754
Rv3492c Mce associated protein 755 755 ctx cooccurence:752
Rv1362c membrane protein 752 753 ctx cooccurence:719

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: Mce associated membrane protein
  • MTBC0 PGAP product: Mce associated membrane protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216488.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E5BU
  • Curated reference: UniProt O53973 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 295 functional partner(s); context anchor mce3F
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002088|Rv1972|
MSVAVDSDAEDDAVSEIAEAAGVSPAPAKPSMSAPRRMLLFGLVVVVALAVLLCCWGFRVQRARHAQDQRGHFLQAARQCALNLTTIDWRNAEADVRRILDGATGEFYNDFAQRSQPFVEVLRHAKASTVGTITEAGLQTQTADTAQALVAVSVQTSNAGEADPVPRAWRMRITVQRVGDRVKVSDVGFVP