cobS Resolved · high auto-curated

H37Rv Rv2208 · MTBC0 mtbc0_002344 · 249 aa · 2498650–2499399 (+) · RefSeq NP_216724.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)adenosylcobinamide-GDP ribazoletransferase
MTBC0 PGAP re-annotationadenosylcobinamide-GDP ribazoletransferase
Revised (this work)Adenosylcobinamide-GDP ribazoletransferase. Pfam: CobS (PF02654.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP91 SwissProt · reviewed · Inferred from homology
UniProt nameAdenosylcobinamide-GDP ribazoletransferase
EC (curated) EC 2.7.8.26
Curated functionJoins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecobS
eggNOG descriptionJoins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate
Orthologous groupCOG0368
EC number EC 2.7.8.26
KEGG orthology K02233
KEGG pathways map00860, map01100
KEGG modules M00122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.288 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CobSPF02654.21 2.6e-448–240 Cobalamin-5-phosphate synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cobT (nicotinate-nucleotide-dimethylbenzimidazol phosphoribosyltransferase), high confidence from genomic context alone (score 992 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2207 cobT nicotinate-nucleotide-dimethylbenzimidazol phosphoribosyltransferase 995 992 ctx neighborhood:882 cooccurence:772 coexpression:467 database:500 textmining:500
Rv0254c cobU bifunctional cobinamide kinase/cobinamide phosphate guanylyltransferase 995 990 ctx neighborhood:461 cooccurence:772 database:900 textmining:539
Rv2066 cobIJ bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase 991 982 coexpression:963 textmining:554
Rv2849c cobO cob(I)alamin adenosyltransferase 996 974 ctx cooccurence:676 database:900 textmining:888
Rv2228c multifunctional RNASE H/alpha-ribazole phosphatase/acid phosphatase 962 944 database:900
Rv1314c cob(I)yrinic acid a,c-diamide adenosyltransferase 920 908 database:900
Rv0255c cobQ1 cobyric acid synthase 946 900 ctx cooccurence:772 coexpression:508 textmining:485
Rv2236c cobD cobalamin biosynthesis transmembrane protein CobD 872 814 ctx cooccurence:770
Rv2206 transmembrane protein 787 787 ctx neighborhood:786
Rv2848c cobB cobyrinic acid A,C-diamide synthase 964 784 ctx cooccurence:730 textmining:843
Rv2071c cobM precorrin-4 C(11)-methyltransferase 819 764 ctx cooccurence:563 coexpression:410
Rv1487 hyp hypothetical protein 749 750 coexpression:749
Rv1570 bioD ATP-dependent dethiobiotin synthetase BioD 776 747 coexpression:746
Rv2231c cobC aminotransferase 768 729 database:500
Rv2070c cobK precorrin-6A reductase 789 725 coexpression:654

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: adenosylcobinamide-GDP ribazoletransferase
  • MTBC0 PGAP product: adenosylcobinamide-GDP ribazoletransferase
  • Pfam (hmmscan --cut_ga): CobS PF02654.21 (E=3e-44)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216724.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CobS (PF02654.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0368
  • Curated reference: UniProt P9WP91 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor cobT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002344|Rv2208|cobS
MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSPLSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIALQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRSVPAAHGSTLGSRVAGTQPAPVVAAWLAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSAVTLAGLARL